StarFunc result for job id Q6MZW2

User Input

>input (842 residues)
MKPGGFWLHLTLLGASLPAALGWMDPGTSRGPDVGVGESQAEEPRSFEVTRREGLSSHNE
LLASCGKKFCSRGSRCVLSRKTGEPECQCLEACRPSYVPVCGSDGRFYENHCKLHRAACL
LGKRITVIHSKDCFLKGDTCTMAGYARLKNVLLALQTRLQPLQEGDSRQDPASQKRLLVE
SLFRDLDADGNGHLSSSELAQHVLKKQDLDEDLLGCSPGDLLRFDDYNSDSSLTLREFYM
AFQVVQLSLAPEDRVSVTTVTVGLSTVLTCAVHGDLRPPIIWKRNGLTLNFLDLEDINDF
GEDDSLYITKVTTIHMGNYTCHASGHEQLFQTHVLQVNVPPVIRVYPESQAQEPGVAASL
RCHAEGIPMPRITWLKNGVDVSTQMSKQLSLLANGSELHISSVRYEDTGAYTCIAKNEVG
VDEDISSLFIEDSARKTLANILWREEGLSVGNMFYVFSDDGIIVIHPVDCEIQRHLKPTE
KIFMSYEEICPQREKNATQPCQWVSAVNVRNRYIYVAQPALSRVLVVDIQAQKVLQSIGV
DPLPAKLSYDKSHDQVWVLSWGDVHKSRPSLQVITEASTGQSQHLIRTPFAGVDDFFIPP
TNLIINHIRFGFIFNKSDPAVHKVDLETMMPLKTIGLHHHGCVPQAMAHTHLGGYFFIQC
RQDSPASAARQLLVDSVTDSVLGPNGDVTGTPHTSPDGRFIVSAAADSPWLHVQEITVRG
EIQTLYDLQINSGISDLAFQRSFTESNQYNIYAALHTEPDLLFLELSTGKVGMLKNLKEP
PAGPAQPWGGTHRIMRDSGLFGQYLLTPARESLFLINGRQNTLRCEVSGIKGGTTVVWVG
EV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5STE3	0.752	0.753	0.000	841	0.837	0.838	Q5STE3.pdb.gz	FSTL4_MOUSE Follistatin-related protein 4 OS=Mus musculus OX=10090 GN=Fstl4 PE=2 SV=1
2	AFDB:Q8N475	0.759	0.756	0.000	847	0.562	0.558	Q8N475.pdb.gz	FSTL5_HUMAN Follistatin-related protein 5 OS=Homo sapiens OX=9606 GN=FSTL5 PE=2 SV=2
3	AFDB:A0A087WV75	0.206	0.197	9.676E-20	884	0.114	0.109	A0A087WV75.pdb.gz	A0A087WV75_HUMAN Neural cell adhesion molecule 1 OS=Homo sapiens OX=9606 GN=NCAM1 PE=1 SV=1
4	AFDB:A0A0R4IAW3	0.197	0.185	1.789E-18	898	0.113	0.106	A0A0R4IAW3.pdb.gz
5	AFDB:P13590	0.204	0.159	1.886E-18	1091	0.108	0.083	P13590.pdb.gz	NCAM1_CHICK Neural cell adhesion molecule 1 OS=Gallus gallus OX=9031 GN=NCAM1 PE=1 SV=3
6	AFDB:Q8IGN3	0.183	0.164	1.989E-18	949	0.160	0.142	Q8IGN3.pdb.gz	Q8IGN3_DROME RE59052p OS=Drosophila melanogaster OX=7227 GN=CG6867 PE=2 SV=1
7	AFDB:P13595	0.202	0.153	3.963E-18	1115	0.109	0.083	P13595.pdb.gz	NCAM1_MOUSE Neural cell adhesion molecule 1 OS=Mus musculus OX=10090 GN=Ncam1 PE=1 SV=3
8	AFDB:Q90YM1	0.188	0.189	8.326E-18	838	0.101	0.101	Q90YM1.pdb.gz
9	AFDB:Q90YM0	0.205	0.217	1.273E-17	795	0.108	0.114	Q90YM0.pdb.gz	Q90YM0_DANRE Cell adhesion molecule OCAM OS=Danio rerio OX=7955 GN=sb:eu836 PE=2 SV=1
10	AFDB:P34082	0.185	0.179	2.674E-17	873	0.101	0.097	P34082.pdb.gz	FAS2_DROME Fasciclin-2 OS=Drosophila melanogaster OX=7227 GN=Fas2 PE=1 SV=1
11	PDB:5oj2B	0.090	0.109	7.051E-12	692	0.101	0.123	5oj2B.pdb.gz
12	PDB:5nnzA	0.298	0.689	7.435E-12	335	0.046	0.116	5nnzA.pdb.gz
13	PDB:6dldD	0.175	0.495	8.267E-12	269	0.067	0.208	6dldD.pdb.gz
14	PDB:7mq8LO	0.260	0.258	1.332E-11	848	0.083	0.083	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:5c2vB	0.220	0.448	2.388E-11	352	0.064	0.153	5c2vB.pdb.gz	The inner workings of the hydrazine synthase multiprotein complex.
16	PDB:5wyjBE	0.238	0.263	5.883E-11	753	0.058	0.065	5wyjBE.pdb.gz	Molecular architecture of the 90S small subunit pre-ribosome.
17	PDB:6lqsB1	0.213	0.221	6.897E-11	806	0.087	0.091	6lqsB1.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
18	PDB:1e07A	0.143	0.179	1.054E-10	642	0.107	0.140	1e07A.pdb.gz
19	PDB:6rtdB	0.329	0.567	1.054E-10	466	0.055	0.099	6rtdB.pdb.gz	Crystal Structure of Dihydro-Heme d1Dehydrogenase NirN from Pseudomonas aeruginosa Reveals Amino Acid Residues Essential for Catalysis.
20	PDB:1gjqA	0.310	0.457	1.172E-10	541	0.055	0.085	1gjqA.pdb.gz	Cyanide Binding to Cd(1) Nitrite Reductase from Pseudomonas Aeruginosa: Role of the Active-Site His369 in Ligand Stabilization.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5STE3	0.0	1477	841	0.837	0.838	FSTL4_MOUSE Follistatin-related protein 4 OS=Mus musculus OX=10090 GN=Fstl4 PE=2 SV=1
2	Q8N475	0.0	1019	847	0.558	0.555	FSTL5_HUMAN Follistatin-related protein 5 OS=Homo sapiens OX=9606 GN=FSTL5 PE=2 SV=2
3	Q96RW7	1.01e-18	94.7	5635	0.089	0.013	HMCN1_HUMAN Hemicentin-1 OS=Homo sapiens OX=9606 GN=HMCN1 PE=1 SV=2
4	Q62356	2.32e-18	89.0	306	0.072	0.199	FSTL1_MOUSE Follistatin-related protein 1 OS=Mus musculus OX=10090 GN=Fstl1 PE=1 SV=2
5	Q12841	2.96e-17	85.9	308	0.070	0.192	FSTL1_HUMAN Follistatin-related protein 1 OS=Homo sapiens OX=9606 GN=FSTL1 PE=1 SV=1
6	Q567W5	3.20e-17	85.9	314	0.078	0.210	Q567W5_DANRE Follistatin-like 1a OS=Danio rerio OX=7955 GN=fstl1 PE=2 SV=1
7	E7F3V2	3.60e-16	86.3	4212	0.075	0.015	E7F3V2_DANRE Hemicentin 2 OS=Danio rerio OX=7955 GN=hmcn2 PE=1 SV=2
8	Q90Z70	7.09e-16	85.1	1513	0.093	0.052	Q90Z70_DANRE Robo2 OS=Danio rerio OX=7955 GN=sb:eu937 PE=2 SV=1
9	A8DZ85	8.99e-16	84.7	1389	0.070	0.042	A8DZ85_DANRE Roundabout homolog 3 OS=Danio rerio OX=7955 GN=cb503 PE=1 SV=1
10	F1QFK4	9.36e-16	84.7	1419	0.070	0.042	F1QFK4_DANRE Roundabout homolog 3 isoform 1 OS=Danio rerio OX=7955 GN=cb503 PE=1 SV=1
11	A0A2R8QRK0	9.45e-16	84.7	1420	0.070	0.042	A0A2R8QRK0_DANRE Roundabout homolog 3 isoform X3 OS=Danio rerio OX=7955 GN=cb503 PE=1 SV=1
12	D3YXG0	9.68e-16	84.7	5634	0.068	0.010	HMCN1_MOUSE Hemicentin-1 OS=Mus musculus OX=10090 GN=Hmcn1 PE=1 SV=1
13	Q8NDA2	1.19e-15	84.7	5059	0.080	0.013	HMCN2_HUMAN Hemicentin-2 OS=Homo sapiens OX=9606 GN=HMCN2 PE=2 SV=3
14	A2AJ76	1.86e-15	84.0	5100	0.081	0.013	HMCN2_MOUSE Hemicentin-2 OS=Mus musculus OX=10090 GN=Hmcn2 PE=1 SV=1
15	Q2PMI2	1.54e-14	77.8	310	0.070	0.190	Q2PMI2_DANRE Follistatin-like 1b OS=Danio rerio OX=7955 GN=fa95c03 PE=1 SV=1
16	Q94538	1.64e-14	80.5	1526	0.070	0.039	Q94538_DROME Frazzled OS=Drosophila melanogaster OX=7227 GN=fra PE=1 SV=1
17	Q94537	1.91e-14	80.5	1375	0.070	0.043	Q94537_DROME Frazzled OS=Drosophila melanogaster OX=7227 GN=fra PE=2 SV=1
18	Q8BQC3	2.04e-14	80.1	813	0.075	0.077	IGDC3_MOUSE Immunoglobulin superfamily DCC subclass member 3 OS=Mus musculus OX=10090 GN=Igdcc3 PE=2 SV=1
19	A0A0B4LEX6	3.72e-14	79.3	1517	0.069	0.038	A0A0B4LEX6_DROME Frazzled, isoform C OS=Drosophila melanogaster OX=7227 GN=fra PE=1 SV=1
20	A1Z920	3.75e-14	79.3	1526	0.069	0.038	A1Z920_DROME FI24025p1 OS=Drosophila melanogaster OX=7227 GN=fra PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	1.2	20.8	Immunoglobulin C1-set domain
2	PF08205 C2-set_2	1.3	20.4	CD80-like C2-set immunoglobulin domain
3	PF00036 EF-hand_1	8.3	17.3	EF hand
4	PF13202 EF-hand_5	3.4	18.5	EF hand
5	PF13405 EF-hand_6	0.2	22.6	EF-hand domain
6	PF13499 EF-hand_7	75	15.2	EF-hand domain pair
7	PF07679 I-set	2.7e-22	90.0	Immunoglobulin I-set domain
8	PF00047 ig	1.6e-12	58.8	Immunoglobulin domain
9	PF13895 Ig_2	1.7e-15	68.4	Immunoglobulin domain
10	PF13927 Ig_3	1.6e-26	103.9	Immunoglobulin domain
11	PF00050 Kazal_1	0.65	21.4	Kazal-type serine protease inhibitor domain
12	PF07648 Kazal_2	0.00016	33.0	Kazal-type serine protease inhibitor domain
13	PF19590 TrbL_3	7.1e+02	10.4	TrbL/VirB6 plasmid conjugal transfer like protein
14	PF07686 V-set	0.19	23.3	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265342

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000259782	0.732	Tubulointerstitial nephritis antigen
2	9606.ENSP00000359904	0.673	tRNA wybutosine-synthesizing protein 3 homolog
3	9606.ENSP00000252809	0.660	Growth differentiation factor 15
4	9606.ENSP00000166139	0.633	Follistatin-related protein 3
5	9606.ENSP00000386738	0.616	E3 ubiquitin-protein ligase KCMF1
6	9606.ENSP00000337065	0.594	C-X-C motif chemokine 14
7	9606.ENSP00000354481	0.519	BMP/retinoic acid-inducible neural-specific protein 2
8	9606.ENSP00000411816	0.513	Chondroitin sulfate N-acetylgalactosaminyltransferase 1
9	9606.ENSP00000396441	0.503	G-patch domain containing 4
10	9606.ENSP00000225388	0.502	Nuclear fragile X mental retardation-interacting protein 2
11	9606.ENSP00000263671	0.500	Chordin-related protein 2 variant III

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0019838	0.994	growth factor binding
GO:0048403	0.404	brain-derived neurotrophic factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0016043	0.842	cellular component organization
GO:0050793	0.815	regulation of developmental process
GO:0048523	0.780	negative regulation of cellular process
GO:0051093	0.752	negative regulation of developmental process
GO:0048583	0.738	regulation of response to stimulus
GO:0010646	0.738	regulation of cell communication
GO:0045595	0.727	regulation of cell differentiation
GO:0022603	0.709	regulation of anatomical structure morphogenesis
GO:2000026	0.672	regulation of multicellular organismal development
GO:0060284	0.670	regulation of cell development
GO:0051241	0.669	negative regulation of multicellular organismal process
GO:0010721	0.656	negative regulation of cell development
GO:0023051	0.647	regulation of signaling
GO:0050770	0.635	regulation of axonogenesis
GO:0009966	0.624	regulation of signal transduction
GO:0061387	0.617	regulation of extent of cell growth
GO:0051960	0.591	regulation of nervous system development
GO:0048585	0.548	negative regulation of response to stimulus
GO:0048670	0.526	regulation of collateral sprouting
GO:0060998	0.492	regulation of dendritic spine development
GO:0010977	0.476	negative regulation of neuron projection development
GO:0032501	0.469	multicellular organismal process
GO:0050771	0.468	negative regulation of axonogenesis
GO:0032502	0.461	developmental process
GO:0048856	0.426	anatomical structure development
GO:0050896	0.390	response to stimulus
GO:0009968	0.377	negative regulation of signal transduction
GO:0048518	0.368	positive regulation of biological process
GO:0007275	0.347	multicellular organism development
GO:0045926	0.343	negative regulation of growth
GO:0048522	0.336	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0012505	0.992	endomembrane system
GO:0031982	0.974	vesicle
GO:0031410	0.897	cytoplasmic vesicle
GO:0099503	0.826	secretory vesicle
GO:0071944	0.756	cell periphery
GO:0005576	0.692	extracellular region
GO:0030141	0.663	secretory granule
GO:0016020	0.338	membrane
GO:0005615	0.324	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]