StarFunc result for job id Q6N021

User Input

>input (2002 residues)
MEQDRTNHVEGNRLSPFLIPSPPICQTEPLATKLQNGSPLPERAHPEVNGDTKWHSFKSY
YGIPCMKGSQNSRVSPDFTQESRGYSKCLQNGGIKRTVSEPSLSGLLQIKKLKQDQKANG
ERRNFGVSQERNPGESSQPNVSDLSDKKESVSSVAQENAVKDFTSFSTHNCSGPENPELQ
ILNEQEGKSANYHDKNIVLLKNKAVLMPNGATVSASSVEHTHGELLEKTLSQYYPDCVSI
AVQKTTSHINAINSQATNELSCEITHPSHTSGQINSAQTSNSELPPKPAAVVSEACDADD
ADNASKLAAMLNTCSFQKPEQLQQQKSVFEICPSPAENNIQGTTKLASGEEFCSGSSSNL
QAPGGSSERYLKQNEMNGAYFKQSSVFTKDSFSATTTPPPPSQLLLSPPPPLPQVPQLPS
EGKSTLNGGVLEEHHHYPNQSNTTLLREVKIEGKPEAPPSQSPNPSTHVCSPSPMLSERP
QNNCVNRNDIQTAGTMTVPLCSEKTRPMSEHLKHNPPIFGSSGELQDNCQQLMRNKEQEI
LKGRDKEQTRDLVPPTQHYLKPGWIELKAPRFHQAESHLKRNEASLPSILQYQPNLSNQM
TSKQYTGNSNMPGGLPRQAYTQKTTQLEHKSQMYQVEMNQGQSQGTVDQHLQFQKPSHQV
HFSKTDHLPKAHVQSLCGTRFHFQQRADSQTEKLMSPVLKQHLNQQASETEPFSNSHLLQ
HKPHKQAAQTQPSQSSHLPQNQQQQQKLQIKNKEEILQTFPHPQSNNDQQREGSFFGQTK
VEECFHGENQYSKSSEFETHNVQMGLEEVQNINRRNSPYSQTMKSSACKIQVSCSNNTHL
VSENKEQTTHPELFAGNKTQNLHHMQYFPNNVIPKQDLLHRCFQEQEQKSQQASVLQGYK
NRNQDMSGQQAAQLAQQRYLIHNHANVFPVPDQGGSHTQTPPQKDTQKHAALRWHLLQKQ
EQQQTQQPQTESCHSQMHRPIKVEPGCKPHACMHTAPPENKTWKKVTKQENPPASCDNVQ
QKSIIETMEQHLKQFHAKSLFDHKALTLKSQKQVKVEMSGPVTVLTRQTTAAELDSHTPA
LEQQTTSSEKTPTKRTAASVLNNFIESPSKLLDTPIKNLLDTPVKTQYDFPSCRCVEQII
EKDEGPFYTHLGAGPNVAAIREIMEERFGQKGKAIRIERVIYTGKEGKSSQGCPIAKWVV
RRSSSEEKLLCLVRERAGHTCEAAVIVILILVWEGIPLSLADKLYSELTETLRKYGTLTN
RRCALNEERTCACQGLDPETCGASFSFGCSWSMYYNGCKFARSKIPRKFKLLGDDPKEEE
KLESHLQNLSTLMAPTYKKLAPDAYNNQIEYEHRAPECRLGLKEGRPFSGVTACLDFCAH
AHRDLHNMQNGSTLVCTLTREDNREFGGKPEDEQLHVLPLYKVSDVDEFGSVEAQEEKKR
SGAIQVLSSFRRKVRMLAEPVKTCRQRKLEAKKAAAEKLSSLENSSNKNEKEKSAPSRTK
QTENASQAKQLAELLRLSGPVMQQSQQPQPLQKQPPQPQQQQRPQQQQPHHPQTESVNSY
SASGSTNPYMRRPNPVSPYPNSSHTSDIYGSTSPMNFYSTSSQAAGSYLNSSNPMNPYPG
LLNQNTQYPSYQCNGNLSVDNCSPYLGSYSPQSQPMDLYRYPSQDPLSKLSLPPIHTLYQ
PRFGNSQSFTSKYLGYGNQNMQGDGFSSCTIRPNVHHVGKLPPYPTHEMDGHFMGATSRL
PPNLSNPNMDYKNGEHHSPSHIIHNYSAAPGMFNSSLHALHLQNKENDMLSHTANGLSKM
LPALNHDRTACVQGGLHKLSDANGQEKQPLALVQGVASGAEDNDEVWSDSEQSFLDPDIG
GVAVAPTHGSILIECAKRELHATTPLKNPNRNHPTRISLVFYQHKSMNEPKHGLALWEAK
MAEKAREKEEECEKYGPDYVPQKSHGKKVKREPAEPHETSEPTYLRFIKSLAERTMSVTT
DSTVTTSPYAFTRVTGPYNRYI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4AC33	0.297	0.308	0.000	1920	0.611	0.637	D4AC33.pdb.gz	D4AC33_RAT Methylcytosine dioxygenase TET OS=Rattus norvegicus OX=10116 GN=Tet2 PE=3 SV=2
2	AFDB:E7F958	0.271	0.314	0.000	1715	0.359	0.419	E7F958.pdb.gz	E7F958_DANRE Methylcytosine dioxygenase TET OS=Danio rerio OX=7955 GN=tet2 PE=2 SV=1
3	AFDB:Q4JK59	0.276	0.287	0.000	1912	0.589	0.617	Q4JK59.pdb.gz	TET2_MOUSE Methylcytosine dioxygenase TET2 OS=Mus musculus OX=10090 GN=Tet2 PE=1 SV=3
4	AFDB:Q6N021	1.000	1.000	0.000	2002	1.000	1.000	Q6N021.pdb.gz	TET2_HUMAN Methylcytosine dioxygenase TET2 OS=Homo sapiens OX=9606 GN=TET2 PE=1 SV=3
5	AFDB:A0A2R8Q4R6	0.253	0.247	9.469E-94	2052	0.283	0.276	A0A2R8Q4R6.pdb.gz	A0A2R8Q4R6_DANRE Methylcytosine dioxygenase TET OS=Danio rerio OX=7955 GN=si:ch211-220a11.1 PE=1 SV=1
6	AFDB:F1R3C6	0.248	0.268	6.229E-91	1855	0.285	0.307	F1R3C6.pdb.gz	F1R3C6_DANRE Methylcytosine dioxygenase TET OS=Danio rerio OX=7955 GN=tet1 PE=2 SV=1
7	AFDB:Q8NFU7	0.236	0.222	3.880E-82	2136	0.277	0.260	Q8NFU7.pdb.gz	TET1_HUMAN Methylcytosine dioxygenase TET1 OS=Homo sapiens OX=9606 GN=TET1 PE=1 SV=2
8	AFDB:Q3URK3	0.242	0.241	2.530E-78	2007	0.268	0.268	Q3URK3.pdb.gz	TET1_MOUSE Methylcytosine dioxygenase TET1 OS=Mus musculus OX=10090 GN=Tet1 PE=1 SV=3
9	AFDB:A0A5F8MPU3	0.035	0.033	2.576E-6	2282	0.134	0.118	A0A5F8MPU3.pdb.gz	CTSRT_MOUSE Cation channel sperm-associated targeting subunit tau OS=Mus musculus OX=10090 GN=C2cd6 PE=1 SV=1
10	AFDB:P98081	0.036	0.033	2.158E-5	2224	0.130	0.117	P98081.pdb.gz	DAB_DROME Protein disabled OS=Drosophila melanogaster OX=7227 GN=Dab PE=1 SV=2
11	PDB:7cy6A	0.075	0.160	1.019E-2	872	0.012	0.029	7cy6A.pdb.gz	Molecular mechanism for vitamin C-derived C 5 -glyceryl-methylcytosine DNA modification catalyzed by algal TET homologue CMD1.
12	PDB:4lt5A	0.076	0.450	1.205E-2	265	0.012	0.091	4lt5A.pdb.gz	Structure of a Naegleria Tet-like dioxygenase in complex with 5-methylcytosine DNA.
13	PDB:4ie6A	0.062	0.218	1.686E-2	447	0.015	0.067	4ie6A.pdb.gz	Structural basis for inhibition of the fat mass and obesity associated protein (FTO)
14	PDB:7pswA	0.055	0.241	3.092E-1	330	0.016	0.097	7pswA.pdb.gz	Spectroscopic studies reveal details of substrate-induced conformational changes distant from the active site in isopenicillin N synthase.
15	PDB:6imcD	0.042	0.188	1.119	340	0.010	0.059	6imcD.pdb.gz	Mammalian ALKBH1 serves as an N6-mA demethylase of unpairing DNA.
16	PDB:6ie2F	0.020	0.104	1.852	324	0.006	0.040	6ie2F.pdb.gz	Structural basis of nucleic acid recognition and 6mA demethylation by human ALKBH1.
17	PDB:2rdnA	0.025	0.127	2.071	275	0.006	0.044	2rdnA.pdb.gz	Crystal Structure of the Non-heme Iron Dioxygenase PtlH in Pentalenolactone Biosynthesis.
18	PDB:7cl4F	0.016	0.092	2.897	285	0.003	0.025	7cl4F.pdb.gz
19	PDB:7etlA	0.017	0.103	3.624	294	0.006	0.044	7etlA.pdb.gz	Structural Insight into the Catalytic Mechanism of the Endoperoxide Synthase FtmOx1.
20	PDB:5i2dA	0.019	0.082	3.832	284	0.008	0.056	5i2dA.pdb.gz	Structural basis of transcription activation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D4AC33	0.0	2144	1920	0.615	0.642	D4AC33_RAT Methylcytosine dioxygenase TET OS=Rattus norvegicus OX=10116 GN=Tet2 PE=3 SV=2
2	E7EQS8	0.0	4161	2023	1.000	0.990	E7EQS8_HUMAN Methylcytosine dioxygenase TET OS=Homo sapiens OX=9606 GN=TET2 PE=1 SV=1
3	E7F958	0.0	1026	1715	0.275	0.321	E7F958_DANRE Methylcytosine dioxygenase TET OS=Danio rerio OX=7955 GN=tet2 PE=2 SV=1
4	F1R3C6	0.0	630	1855	0.146	0.157	F1R3C6_DANRE Methylcytosine dioxygenase TET OS=Danio rerio OX=7955 GN=tet1 PE=2 SV=1
5	O43151	0.0	602	1795	0.152	0.170	TET3_HUMAN Methylcytosine dioxygenase TET3 OS=Homo sapiens OX=9606 GN=TET3 PE=1 SV=4
6	Q4JK59	0.0	1954	1912	0.588	0.616	TET2_MOUSE Methylcytosine dioxygenase TET2 OS=Mus musculus OX=10090 GN=Tet2 PE=1 SV=3
7	Q6N021	0.0	4165	2002	1.000	1.000	TET2_HUMAN Methylcytosine dioxygenase TET2 OS=Homo sapiens OX=9606 GN=TET2 PE=1 SV=3
8	Q8BG87	1.89e-180	598	1803	0.151	0.167	TET3_MOUSE Methylcytosine dioxygenase TET3 OS=Mus musculus OX=10090 GN=Tet3 PE=1 SV=4
9	A0A2R8Q4R6	1.32e-174	587	2052	0.149	0.145	A0A2R8Q4R6_DANRE Methylcytosine dioxygenase TET OS=Danio rerio OX=7955 GN=si:ch211-220a11.1 PE=1 SV=1
10	Q8NFU7	1.47e-157	539	2136	0.133	0.125	TET1_HUMAN Methylcytosine dioxygenase TET1 OS=Homo sapiens OX=9606 GN=TET1 PE=1 SV=2
11	Q3URK3	5.21e-146	503	2007	0.120	0.120	TET1_MOUSE Methylcytosine dioxygenase TET1 OS=Mus musculus OX=10090 GN=Tet1 PE=1 SV=3
12	M9NEY8	1.27e-114	409	2860	0.095	0.066	TET_DROME Methylcytosine dioxygenase TET OS=Drosophila melanogaster OX=7227 GN=Tet PE=1 SV=1
13	Q9ZVI7	9.5	33.5	619	0.025	0.082	GAUT7_ARATH Probable galacturonosyltransferase 7 OS=Arabidopsis thaliana OX=3702 GN=GAUT7 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12851 Tet_JBP	6.9e-148	504.1	Oxygenase domain of the 2OGFeDO superfamily

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000442788

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362824	0.995	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
2	9606.ENSP00000430432	0.989	Histone deacetylase 2
3	9606.ENSP00000229307	0.987	Homeobox protein NANOG
4	9606.ENSP00000378248	0.987	CXXC-type zinc finger protein 4
5	9606.ENSP00000331327	0.981	Wilms tumor protein
6	9606.ENSP00000227163	0.947	Transcription factor PU.1
7	9606.ENSP00000385824	0.935	Forkhead box protein O3
8	9606.ENSP00000322898	0.922	Transcription factor COE1
9	9606.ENSP00000364839	0.916	Putative Polycomb group protein ASXL1
10	9606.ENSP00000264709	0.915	DNA (cytosine-5)-methyltransferase 3A
11	9606.ENSP00000352516	0.896	DNA (cytosine-5)-methyltransferase 1
12	9606.ENSP00000325663	0.893	NF-kappa-B inhibitor zeta
13	9606.ENSP00000331897	0.870	Isocitrate dehydrogenase [NADP], mitochondrial
14	9606.ENSP00000390265	0.868	Isocitrate dehydrogenase 1, cytosolic
15	9606.ENSP00000328547	0.859	DNA (cytosine-5)-methyltransferase 3B
16	9606.ENSP00000376611	0.852	G/T mismatch-specific thymine DNA glycosylase
17	9606.ENSP00000436786	0.829	Histone-lysine N-methyltransferase 2A
18	9606.ENSP00000376276	0.824	Serine/arginine-rich splicing factor 2
19	9606.ENSP00000270172	0.821	DNA (cytosine-5)-methyltransferase 3-like
20	9606.ENSP00000378402	0.816	Paired amphipathic helix protein Sin3a

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0070579	1.000	methylcytosine dioxygenase activity
GO:0046914	0.948	transition metal ion binding
GO:0008270	0.940	zinc ion binding
GO:0005506	0.923	iron ion binding
GO:0008198	0.907	ferrous iron binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.989	organic substance metabolic process
GO:0009987	0.987	cellular process
GO:2001141	0.986	regulation of RNA biosynthetic process
GO:0044238	0.985	primary metabolic process
GO:0010468	0.973	regulation of gene expression
GO:0048522	0.970	positive regulation of cellular process
GO:0044237	0.964	cellular metabolic process
GO:0006807	0.961	nitrogen compound metabolic process
GO:0006355	0.951	regulation of DNA-templated transcription
GO:0010604	0.941	positive regulation of macromolecule metabolic process
GO:0070988	0.935	demethylation
GO:0043170	0.934	macromolecule metabolic process
GO:0048856	0.918	anatomical structure development
GO:0043412	0.912	macromolecule modification
GO:0051173	0.890	positive regulation of nitrogen compound metabolic process
GO:0031325	0.881	positive regulation of cellular metabolic process
GO:0090304	0.869	nucleic acid metabolic process
GO:0044260	0.866	cellular macromolecule metabolic process
GO:0010557	0.859	positive regulation of macromolecule biosynthetic process
GO:0051254	0.859	positive regulation of RNA metabolic process
GO:0045893	0.851	positive regulation of DNA-templated transcription
GO:1901564	0.833	organonitrogen compound metabolic process
GO:0006357	0.817	regulation of transcription by RNA polymerase II
GO:0030097	0.759	hemopoiesis
GO:0006259	0.745	DNA metabolic process
GO:0036211	0.740	protein modification process
GO:0006304	0.728	DNA modification
GO:0050896	0.685	response to stimulus
GO:0048519	0.512	negative regulation of biological process
GO:0048523	0.495	negative regulation of cellular process
GO:0051716	0.380	cellular response to stimulus
GO:0045944	0.344	positive regulation of transcription by RNA polymerase II
GO:0032501	0.328	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.939	protein-containing complex
GO:0005737	0.511	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:52636	1.000	2-oxoglutarate + a 5-methyl-2'-deoxycytidine in DNA + O2 = a 5-hydroxymethyl-2'-deoxycytidine in DNA + CO2 + succinate
EC:1.14.11.n2	1.000	Transferred entry: 1.14.11.80.

[back to server]