StarFunc result for job id Q6N022

User Input

>input (1400 residues)
MDVKERKPYRSLTRRRDAERRYTSSSADSEEGKAPQKSYSSSETLKAYDQDARLAYGSRV
KDIVPQEAEEFCRTGANFTLRELGLEEVTPPHGTLYRTDIGLPHCGYSMGAGSDADMEAD
TVLSPEHPVRLWGRSTRSGRSSCLSSRANSNLTLTDTEHENTETDHPGGLQNHARLRTPP
PPLSHAHTPNQHHAASINSLNRGNFTPRSNPSPAPTDHSLSGEPPAGGAQEPAHAQENWL
LNSNIPLETRNLGKQPFLGTLQDNLIEMDILGASRHDGAYSDGHFLFKPGGTSPLFCTTS
PGYPLTSSTVYSPPPRPLPRSTFARPAFNLKKPSKYCNWKCAALSAIVISATLVILLAYF
VAMHLFGLNWHLQPMEGQMYEITEDTASSWPVPTDVSLYPSGGTGLETPDRKGKGTTEGK
PSSFFPEDSFIDSGEIDVGRRASQKIPPGTFWRSQVFIDHPVHLKFNVSLGKAALVGIYG
RKGLPPSHTQFDFVELLDGRRLLTQEARSLEGTPRQSRGTVPPSSHETGFIQYLDSGIWH
LAFYNDGKESEVVSFLTTAIESVDNCPSNCYGNGDCISGTCHCFLGFLGPDCGRASCPVL
CSGNGQYMKGRCLCHSGWKGAECDVPTNQCIDVACSNHGTCITGTCICNPGYKGESCEEV
DCMDPTCSGRGVCVRGECHCSVGWGGTNCETPRATCLDQCSGHGTFLPDTGLCSCDPSWT
GHDCSIEICAADCGGHGVCVGGTCRCEDGWMGAACDQRACHPRCAEHGTCRDGKCECSPG
WNGEHCTIAHYLDRVVKEGCPGLCNGNGRCTLDLNGWHCVCQLGWRGAGCDTSMETACGD
SKDNDGDGLVDCMDPDCCLQPLCHINPLCLGSPNPLDIIQETQVPVSQQNLHSFYDRIKF
LVGRDSTHIIPGENPFDGGHACVIRGQVMTSDGTPLVGVNISFVNNPLFGYTISRQDGSF
DLVTNGGISIILRFERAPFITQEHTLWLPWDRFFVMETIIMRHEENEIPSCDLSNFARPN
PVVSPSPLTSFASSCAEKGPIVPEIQALQEEISISGCKMRLSYLSSRTPGYKSVLRISLT
HPTIPFNLMKVHLMVAVEGRLFRKWFAAAPDLSYYFIWDKTDVYNQKVFGLSEAFVSVGY
EYESCPDLILWEKRTTVLQGYEIDASKLGGWSLDKHHALNIQSGILHKGNGENQFVSQQP
PVIGSIMGNGRRRSISCPSCNGLADGNKLLAPVALTCGSDGSLYVGDFNYIRRIFPSGNV
TNILELRNKDFRHSHSPAHKYYLATDPMSGAVFLSDSNSRRVFKIKSTVVVKDLVKNSEV
VAGTGDQCLPFDDTRCGDGGKATEATLTNPRGITVDKFGLIYFVDGTMIRRIDQNGIIST
LLGSNDLTSARPLSCDSVMD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:5es4B	0.057	0.097	4.149E-8	674	0.039	0.080	5es4B.pdb.gz	Leukocyte integrin alpha L beta 2 headpiece structures: The alpha I domain, the pocket for the internal ligand, and concerted movements of its loops.
2	PDB:4g1eB	0.058	0.096	5.597E-7	709	0.041	0.082	4g1eB.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
3	PDB:1nr0A	0.082	0.169	1.500E-4	610	0.048	0.110	1nr0A.pdb.gz
4	PDB:5iv5BJ	0.072	0.097	4.294E-4	1004	0.029	0.040	5iv5BJ.pdb.gz	Structure of the T4 baseplate and its function in triggering sheath contraction.
5	PDB:2r51A	0.054	0.197	4.797E-4	288	0.015	0.073	2r51A.pdb.gz
6	PDB:7zp6A	0.076	0.285	5.986E-4	321	0.018	0.078	7zp6A.pdb.gz
7	PDB:2nsmA	0.051	0.172	6.327E-4	390	0.009	0.033	2nsmA.pdb.gz
8	PDB:6lqsB1	0.080	0.127	6.327E-4	806	0.029	0.051	6lqsB1.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
9	PDB:7sqcO1	0.058	0.112	6.687E-4	673	0.023	0.048	7sqcO1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
10	PDB:5f0jB	0.055	0.187	7.470E-4	306	0.021	0.095	5f0jB.pdb.gz
11	AFDB:Q03692	0.051	0.094	2.145E-3	680	0.062	0.128	Q03692.pdb.gz	COAA1_HUMAN Collagen alpha-1(X) chain OS=Homo sapiens OX=9606 GN=COL10A1 PE=1 SV=2
12	AFDB:Q8TEP8	0.053	0.036	2.677E-3	2537	0.086	0.047	Q8TEP8.pdb.gz	CE192_HUMAN Centrosomal protein of 192 kDa OS=Homo sapiens OX=9606 GN=CEP192 PE=1 SV=3
13	AFDB:Q54NE5	0.047	0.036	4.406E-3	1918	0.100	0.073	Q54NE5.pdb.gz	Q54NE5_DICDI Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0285313 PE=4 SV=1
14	AFDB:E9Q4Y4	0.057	0.039	5.202E-3	2514	0.094	0.052	E9Q4Y4.pdb.gz	E9Q4Y4_MOUSE Centrosomal protein 192 OS=Mus musculus OX=10090 GN=Cep192 PE=1 SV=1
15	AFDB:G5EGT0	0.028	0.036	1.034E-1	1019	0.048	0.066	G5EGT0.pdb.gz	G5EGT0_CAEEL cGMP-dependent protein kinase interacting domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=mel-11 PE=1 SV=1
16	AFDB:B7YZW3	0.048	0.036	2.959E-1	2064	0.111	0.076	B7YZW3.pdb.gz	B7YZW3_DROME Miles to go, isoform E OS=Drosophila melanogaster OX=7227 GN=mtgo PE=1 SV=1
17	AFDB:Q2EG98	0.060	0.039	2.959E-1	2201	0.061	0.039	Q2EG98.pdb.gz	PK1L3_MOUSE Polycystin-1-like protein 3 OS=Mus musculus OX=10090 GN=Pkd1l3 PE=1 SV=2
18	AFDB:Q388H5	0.031	0.053	3.693E-1	677	0.051	0.106	Q388H5.pdb.gz	Q388H5_TRYB2 FCP1 homology domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.2520 PE=4 SV=1
19	AFDB:B7Z0K1	0.057	0.068	3.903E-1	1137	0.114	0.141	B7Z0K1.pdb.gz	B7Z0K1_DROME Bitesize, isoform H OS=Drosophila melanogaster OX=7227 GN=btsz PE=4 SV=1
20	AFDB:Q3V1M1	0.043	0.027	5.148E-1	2594	0.101	0.054	Q3V1M1.pdb.gz	IGS10_MOUSE Immunoglobulin superfamily member 10 OS=Mus musculus OX=10090 GN=Igsf10 PE=2 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O61307	0.0	788	2731	0.280	0.144	TENM_DROME Teneurin-m OS=Drosophila melanogaster OX=7227 GN=Ten-m PE=1 SV=2
2	Q3UHK6	0.0	2858	2771	0.967	0.489	TEN4_MOUSE Teneurin-4 OS=Mus musculus OX=10090 GN=Tenm4 PE=1 SV=2
3	Q6N022	0.0	2942	2769	1.000	0.506	TEN4_HUMAN Teneurin-4 OS=Homo sapiens OX=9606 GN=TENM4 PE=1 SV=2
4	Q9DER5	0.0	1586	2802	0.548	0.274	TEN2_CHICK Teneurin-2 OS=Gallus gallus OX=9031 GN=TENM2 PE=1 SV=1
5	Q9NT68	0.0	1615	2774	0.552	0.279	TEN2_HUMAN Teneurin-2 OS=Homo sapiens OX=9606 GN=TENM2 PE=1 SV=3
6	Q9P273	0.0	1843	2699	0.646	0.335	TEN3_HUMAN Teneurin-3 OS=Homo sapiens OX=9606 GN=TENM3 PE=1 SV=3
7	Q9R1K2	0.0	1599	2774	0.546	0.275	TEN2_RAT Teneurin-2 OS=Rattus norvegicus OX=10116 GN=Tenm2 PE=1 SV=2
8	Q9UKZ4	0.0	1619	2725	0.575	0.295	TEN1_HUMAN Teneurin-1 OS=Homo sapiens OX=9606 GN=TENM1 PE=1 SV=2
9	Q9VYN8	0.0	714	3004	0.256	0.119	TENA_DROME Teneurin-a OS=Drosophila melanogaster OX=7227 GN=Ten-a PE=1 SV=2
10	Q9W6V6	0.0	1661	2705	0.576	0.298	TEN1_CHICK Teneurin-1 OS=Gallus gallus OX=9031 GN=TENM1 PE=1 SV=1
11	Q9W7R3	0.0	2066	2824	0.700	0.347	TEN4_DANRE Teneurin-4 OS=Danio rerio OX=7955 GN=tenm4 PE=2 SV=1
12	Q9W7R4	0.0	1703	2694	0.589	0.306	TEN3_DANRE Teneurin-3 OS=Danio rerio OX=7955 GN=tenm3 PE=2 SV=2
13	Q9WTS4	0.0	1636	2731	0.578	0.296	TEN1_MOUSE Teneurin-1 OS=Mus musculus OX=10090 GN=Tenm1 PE=1 SV=1
14	Q9WTS5	0.0	1596	2764	0.548	0.277	TEN2_MOUSE Teneurin-2 OS=Mus musculus OX=10090 GN=Tenm2 PE=1 SV=1
15	Q9WTS6	0.0	1888	2715	0.649	0.335	TEN3_MOUSE Teneurin-3 OS=Mus musculus OX=10090 GN=Tenm3 PE=1 SV=1
16	H1ZUX0	7.93e-135	462	2837	0.227	0.112	H1ZUX0_CAEEL EGF-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ten-1 PE=1 SV=1
17	H1ZUX1	9.65e-135	462	2763	0.227	0.115	H1ZUX1_CAEEL EGF-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ten-1 PE=1 SV=1
18	G5EGQ6	1.60e-134	462	2684	0.227	0.118	TEN1_CAEEL Teneurin-1 OS=Caenorhabditis elegans OX=6239 GN=ten-1 PE=1 SV=1
19	A0A5F8MPH8	5.04e-50	198	4356	0.076	0.025	A0A5F8MPH8_MOUSE Tenascin XB OS=Mus musculus OX=10090 GN=Tnxb PE=1 SV=1
20	A0A571BG59	7.84e-50	197	4114	0.076	0.026	A0A571BG59_MOUSE Tenascin XB OS=Mus musculus OX=10090 GN=Tnxb PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13620 CarboxypepD_reg	31	16.3	Carboxypeptidase regulatory-like domain
2	PF00008 EGF	47	15.7	EGF-like domain
3	PF07974 EGF_2	8e-24	95.0	EGF-like domain
4	PF12661 hEGF	0.013	27.3	Human growth factor-like EGF
5	PF18372 I-EGF_1	10	17.5	Integrin beta epidermal growth factor like domain 1
6	PF12971 NAGLU_N	35	15.6	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain
7	PF06484 Ten_N	7.9e-145	494.7	Teneurin Intracellular Region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000278550

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000340688	0.891	Adhesion G protein-coupled receptor L1
2	9606.ENSP00000360858	0.861	Noelin
3	9606.ENSP00000422533	0.782	Adhesion G protein-coupled receptor L3
4	9606.ENSP00000322270	0.737	Adhesion G protein-coupled receptor L2
5	9606.ENSP00000386357	0.723	Leucine-rich repeat transmembrane neuronal protein 4
6	9606.ENSP00000280772	0.691	Ankyrin-3
7	9606.ENSP00000288078	0.690	L-fucose kinase
8	9606.ENSP00000266376	0.674	Voltage-dependent L-type calcium channel subunit alpha-1C
9	9606.ENSP00000416168	0.669	Tetratricopeptide repeat and ankyrin repeat containing 1
10	9606.ENSP00000366395	0.652	E3 ubiquitin-protein ligase synoviolin
11	9606.ENSP00000362649	0.642	Histone deacetylase 1
12	9606.ENSP00000396954	0.635	Cyclic AMP-dependent transcription factor ATF-5
13	9606.ENSP00000252575	0.617	Neurocan core protein
14	9606.ENSP00000289228	0.609	Beta-centractin
15	9606.ENSP00000265171	0.607	Pro-epidermal growth factor
16	9606.ENSP00000261758	0.600	LRP chaperone MESD
17	9606.ENSP00000222747	0.583	Tetraspanin-12
18	9606.ENSP00000415769	0.579	Inter-alpha-trypsin inhibitor heavy chain H3
19	9606.ENSP00000361653	0.576	Forkhead box protein J3
20	9606.ENSP00000256707	0.571	Kinase D-interacting substrate of 220 kDa

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.993	identical protein binding
GO:0046983	0.990	protein dimerization activity
GO:0042803	0.704	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.990	multicellular organismal process
GO:0032502	0.988	developmental process
GO:0050794	0.956	regulation of cellular process
GO:0007275	0.952	multicellular organism development
GO:0009987	0.926	cellular process
GO:0007399	0.910	nervous system development
GO:0071840	0.786	cellular component organization or biogenesis
GO:0048518	0.652	positive regulation of biological process
GO:0022008	0.647	neurogenesis
GO:0007272	0.615	ensheathment of neurons
GO:0048468	0.601	cell development
GO:0042063	0.589	gliogenesis
GO:0007155	0.588	cell adhesion
GO:0009653	0.580	anatomical structure morphogenesis
GO:0007417	0.559	central nervous system development
GO:0048522	0.523	positive regulation of cellular process
GO:0010001	0.440	glial cell differentiation
GO:0051960	0.438	regulation of nervous system development
GO:0008366	0.437	axon ensheathment
GO:0032291	0.402	axon ensheathment in central nervous system
GO:0031641	0.397	regulation of myelination
GO:0016043	0.349	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	1.000	cell periphery
GO:0016020	1.000	membrane
GO:0005886	0.987	plasma membrane
GO:0005622	0.552	intracellular anatomical structure
GO:0043226	0.447	organelle
GO:0043229	0.408	intracellular organelle
GO:0043227	0.397	membrane-bounded organelle
GO:0005737	0.327	cytoplasm
GO:0043231	0.312	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]