StarFunc result for job id Q6N069

User Input

>input (864 residues)
MPNVLLPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLG
KKEEAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDL
SLLQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQTQQV
PPNKIDYEYSELILYQNQVMREADLLQESLEHIEMYEKQICDKLLVEEIKGEILLKLGRL
KEASEVFKNLIDRNAENWCYYEGLEKALQISTLEERLQIYEEISKQHPKAITPRRLPLTL
VPGERFRELMDKFLRVNFSKGCPPLFTTLKSLYYNTEKVSIIQELVTNYEASLKTCDFFS
PYENGEKEPPTTLLWVQYFLAQHFDKLGQYSLALDYINAAIASTPTLIELFYMKAKIYKH
IGNLKEAAKWMDEAQSLDTADRFINSKCAKYMLRANMIKEAEEMCSKFTREGTSAMENLN
EMQCMWFQTECISAYQRLGRYGDALKKCHEVERHFFEITDDQFDFHTYCMRKMTLRAYVD
LLRLEDILRRHAFYFKAARSAIEIYLKLYDNPLTNESKQQEINSENLSAKELKKMLSKQR
RAQKKAKLEEERKHAERERQQKNQKKKRDEEEEEASGLKEELIPEKLERVENPLEEAVKF
LIPLKNLVADNIDTHLLAFEIYFRKGKFLLMLQSVKRAFAINSNNPWLHECLIRFSKSVS
NHSNLPDIVSKVLSQEMQKIFVKKDLESFNEDFLKRNATSLQHLLSGAKMMYFLDKSRQE
KAIAIATRLDETIKDKDVKTLIKVSEALLDGSFGNCSSQYEEYRMACHNLLPFTSAFLPA
VNEVDNPNVALNHTANYDVLANEI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A4FU51	0.964	0.964	3.855E-92	864	1.000	1.000	A4FU51.pdb.gz	A4FU51_HUMAN NMDA receptor regulated 1-like OS=Homo sapiens OX=9606 GN=NARG1L PE=2 SV=1
2	AFDB:Q9BXJ9	0.960	0.958	8.173E-75	866	0.705	0.703	Q9BXJ9.pdb.gz	NAA15_HUMAN N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA15 PE=1 SV=1
3	AFDB:A0A0R4I9S5	0.969	0.968	5.175E-74	865	0.678	0.677	A0A0R4I9S5.pdb.gz	A0A0R4I9S5_DANRE N(Alpha)-acetyltransferase 15, NatA auxiliary subunit b OS=Danio rerio OX=7955 GN=fi31d06 PE=1 SV=2
4	AFDB:F1QE25	0.971	0.967	9.462E-74	867	0.676	0.674	F1QE25.pdb.gz	F1QE25_DANRE N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Danio rerio OX=7955 GN=narg1a PE=1 SV=1
5	PDB:6c95A	0.872	0.973	7.100E-64	773	0.647	0.723	6c95A.pdb.gz	Structure of Human NatA and Its Regulation by the Huntingtin Interacting Protein HYPK.
6	AFDB:Q9VWI2	0.929	0.903	1.193E-61	890	0.520	0.504	Q9VWI2.pdb.gz	Q9VWI2_DROME N(Alpha)-acetyltransferase 15/16, isoform A OS=Drosophila melanogaster OX=7227 GN=Naa15-16 PE=1 SV=1
7	AFDB:F4HS68	0.885	0.841	4.230E-48	911	0.407	0.386	F4HS68.pdb.gz	F4HS68_ARATH Tetratricopeptide repeat (TPR)-containing protein OS=Arabidopsis thaliana OX=3702 GN=NAA15 PE=1 SV=1
8	AFDB:O74985	0.757	0.890	3.857E-37	729	0.329	0.390	O74985.pdb.gz	NAT1_SCHPO N-terminal acetyltransferase A complex subunit nat1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nat1 PE=1 SV=1
9	PDB:4kvmB	0.741	0.878	4.588E-35	722	0.325	0.389	4kvmB.pdb.gz	Molecular basis for N-terminal acetylation by the heterodimeric NatA complex.
10	AFDB:P12945	0.741	0.750	4.927E-30	854	0.282	0.286	P12945.pdb.gz	NAT1_YEAST N-terminal acetyltransferase A complex subunit NAT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NAT1 PE=1 SV=2
11	PDB:4xnhA	0.732	0.800	2.093E-28	786	0.267	0.294	4xnhA.pdb.gz	Crystal structure of yeast N-terminal acetyltransferase NatE (IP6) in complex with a bisubstrate
12	AFDB:Q38B37	0.680	0.816	1.296E-27	711	0.223	0.271	Q38B37.pdb.gz	Q38B37_TRYB2 N-acetyltransferase subunit Nat1, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.1320 PE=4 SV=1
13	PDB:6hd7t	0.764	0.786	9.338E-27	838	0.288	0.297	6hd7t.pdb.gz	Ribosome-NatA architecture reveals that rRNA expansion segments coordinate N-terminal acetylation.
14	PDB:4hnxA	0.662	0.796	3.744E-25	713	0.256	0.310	4hnxA.pdb.gz	The Protein Complex NatA Binds Inositol Hexakisphosphate and Exhibits Conformational Flexibility
15	AFDB:Q9Y7X2	0.676	0.829	2.413E-23	695	0.200	0.249	Q9Y7X2.pdb.gz	YOP2_SCHPO N-terminal acetyltransferase A complex subunit-like protein C418.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC418.02 PE=3 SV=1
16	PDB:7dkhI	0.184	0.175	4.619E-10	914	0.135	0.128	7dkhI.pdb.gz
17	PDB:7qdrB	0.174	0.137	1.162E-9	1212	0.140	0.100	7qdrB.pdb.gz
18	PDB:4bujB	0.204	0.138	6.163E-9	1367	0.124	0.078	4bujB.pdb.gz
19	PDB:6vp9B	0.472	0.450	1.607E-8	914	0.111	0.105	6vp9B.pdb.gz	Molecular basis for N-terminal alpha-synuclein acetylation by human NatB.
20	PDB:7ntfA	0.203	0.193	2.641E-8	918	0.084	0.080	7ntfA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0B4J1W3	0.0	1251	865	0.706	0.705	A0A0B4J1W3_HUMAN N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA15 PE=1 SV=1
2	A0A0R4I9S5	0.0	1214	865	0.679	0.679	A0A0R4I9S5_DANRE N(Alpha)-acetyltransferase 15, NatA auxiliary subunit b OS=Danio rerio OX=7955 GN=fi31d06 PE=1 SV=2
3	A4FU51	0.0	1782	864	1.000	1.000	A4FU51_HUMAN NMDA receptor regulated 1-like OS=Homo sapiens OX=9606 GN=NARG1L PE=2 SV=1
4	F1QE25	0.0	1209	867	0.677	0.675	F1QE25_DANRE N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Danio rerio OX=7955 GN=narg1a PE=1 SV=1
5	F4HS68	0.0	603	911	0.402	0.381	F4HS68_ARATH Tetratricopeptide repeat (TPR)-containing protein OS=Arabidopsis thaliana OX=3702 GN=NAA15 PE=1 SV=1
6	Q6N069	0.0	1782	864	1.000	1.000	NAA16_HUMAN N-alpha-acetyltransferase 16, NatA auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA16 PE=1 SV=2
7	Q80UM3	0.0	1247	865	0.701	0.701	NAA15_MOUSE N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Mus musculus OX=10090 GN=Naa15 PE=1 SV=1
8	Q9BXJ9	0.0	1249	866	0.707	0.706	NAA15_HUMAN N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA15 PE=1 SV=1
9	Q9VWI2	0.0	928	890	0.523	0.508	Q9VWI2_DROME N(Alpha)-acetyltransferase 15/16, isoform A OS=Drosophila melanogaster OX=7227 GN=Naa15-16 PE=1 SV=1
10	O74985	1.10e-150	462	729	0.328	0.388	NAT1_SCHPO N-terminal acetyltransferase A complex subunit nat1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nat1 PE=1 SV=1
11	P12945	5.98e-93	313	854	0.275	0.279	NAT1_YEAST N-terminal acetyltransferase A complex subunit NAT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NAT1 PE=1 SV=2
12	Q38B37	2.47e-81	278	711	0.204	0.248	Q38B37_TRYB2 N-acetyltransferase subunit Nat1, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.1320 PE=4 SV=1
13	Q9NFL7	2.54e-81	278	711	0.204	0.248	Q9NFL7_9TRYP Putative N-acetyltransferase subunit NAT1 OS=Trypanosoma brucei OX=5691 GN=NAT1 PE=4 SV=1
14	Q9Y7X2	2.59e-45	176	695	0.201	0.250	YOP2_SCHPO N-terminal acetyltransferase A complex subunit-like protein C418.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC418.02 PE=3 SV=1
15	Q6PGP7	0.004	43.5	1564	0.060	0.033	SKI3_HUMAN Superkiller complex protein 3 OS=Homo sapiens OX=9606 GN=SKIC3 PE=1 SV=1
16	F4JS25	0.011	42.0	1052	0.046	0.038	SRFR1_ARATH Suppressor of RPS4-RLD 1 OS=Arabidopsis thaliana OX=3702 GN=SRFR1 PE=1 SV=1
17	O94474	0.012	42.0	1389	0.056	0.035	SKI3_SCHPO Superkiller protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ski3 PE=3 SV=1
18	Q9VS37	0.014	41.6	900	0.044	0.042	Q9VS37_DROME Cell division cycle 27, isoform A OS=Drosophila melanogaster OX=7227 GN=Cdc27 PE=1 SV=1
19	Q96RK4	0.032	40.0	519	0.078	0.129	BBS4_HUMAN Bardet-Biedl syndrome 4 protein OS=Homo sapiens OX=9606 GN=BBS4 PE=1 SV=2
20	E9QEX9	0.16	38.1	2607	0.027	0.009	E9QEX9_DANRE Ankyrin repeat and KH domain-containing 1 OS=Danio rerio OX=7955 GN=ankhd1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12895 ANAPC3	1.4e-05	36.5	Anaphase-promoting complex, cyclosome, subunit 3
2	PF15928 DUF4746	3.1e+02	12.2	Domain of unknown function (DUF4746)
3	PF05623 DUF789	3.7e+02	12.2	Protein of unknown function (DUF789)
4	PF12569 NatA_aux_su	4e-217	733.8	N-terminal acetyltransferase A, auxiliary subunit
5	PF00515 TPR_1	4.2e-10	50.2	Tetratricopeptide repeat
6	PF13374 TPR_10	17	16.6	Tetratricopeptide repeat
7	PF13414 TPR_11	1.8e-06	38.8	TPR repeat
8	PF13424 TPR_12	0.00061	31.4	Tetratricopeptide repeat
9	PF13428 TPR_14	7.9e-12	55.9	Tetratricopeptide repeat
10	PF13429 TPR_15	0.059	24.3	Tetratricopeptide repeat
11	PF13432 TPR_16	2.3e-05	36.2	Tetratricopeptide repeat
12	PF13431 TPR_17	18	17.0	Tetratricopeptide repeat
13	PF14559 TPR_19	1.6e-06	39.8	Tetratricopeptide repeat
14	PF07719 TPR_2	1.9e-13	60.4	Tetratricopeptide repeat
15	PF07720 TPR_3	4.2e+02	12.4	Tetratricopeptide repeat
16	PF13176 TPR_7	0.018	26.1	Tetratricopeptide repeat
17	PF13181 TPR_8	4.9e-12	56.1	Tetratricopeptide repeat
18	PF13371 TPR_9	0.5	21.8	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000368716

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000417763	0.998	N-alpha-acetyltransferase 10
2	9606.ENSP00000286794	0.996	N-alpha-acetyltransferase 11
3	9606.ENSP00000240922	0.987	N-alpha-acetyltransferase 50
4	9606.ENSP00000452521	0.983	N-alpha-acetyltransferase 30
5	9606.ENSP00000354972	0.964	N-alpha-acetyltransferase 35, NatC auxiliary subunit
6	9606.ENSP00000296543	0.961	N-alpha-acetyltransferase 15, NatA auxiliary subunit
7	9606.ENSP00000335636	0.932	N-alpha-acetyltransferase 20
8	9606.ENSP00000261745	0.923	N-alpha-acetyltransferase 25, NatB auxiliary subunit
9	9606.ENSP00000332103	0.901	N-alpha-acetyltransferase 38, NatC auxiliary subunit
10	9606.ENSP00000384474	0.881	Huntingtin-interacting protein K
11	9606.ENSP00000385903	0.840	N-alpha-acetyltransferase 60
12	9606.ENSP00000368612	0.754	Von Willebrand factor A domain-containing protein 8
13	9606.ENSP00000368793	0.752	Peptide chain release factor 1, mitochondrial
14	9606.ENSP00000392318	0.746	Cysteine-rich protein 2-binding protein
15	9606.ENSP00000357047	0.726	Mediator of RNA polymerase II transcription subunit 23
16	9606.ENSP00000440190	0.715	Tudor domain-containing protein 3
17	9606.ENSP00000367075	0.667	Kelch-like protein 1
18	9606.ENSP00000337572	0.649	Diacylglycerol kinase eta
19	9606.ENSP00000367024	0.639	N-alpha-acetyltransferase 40
20	9606.ENSP00000367177	0.626	Protocadherin-8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0043022	0.999	ribosome binding
GO:0016407	0.987	acetyltransferase activity
GO:0003676	0.976	nucleic acid binding
GO:0003723	0.957	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0019538	0.989	protein metabolic process
GO:0031365	0.982	N-terminal protein amino acid modification
GO:0010467	0.976	gene expression
GO:0006473	0.954	protein acetylation
GO:0050789	0.926	regulation of biological process
GO:0051604	0.857	protein maturation
GO:0050794	0.682	regulation of cellular process
GO:0009987	0.400	cellular process
GO:0048519	0.302	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0032991	0.986	protein-containing complex
GO:0043227	0.973	membrane-bounded organelle
GO:0005576	0.950	extracellular region
GO:0005634	0.947	nucleus
GO:0070013	0.926	intracellular organelle lumen
GO:0043232	0.925	intracellular non-membrane-bounded organelle
GO:0031981	0.905	nuclear lumen
GO:0140535	0.831	intracellular protein-containing complex
GO:0005654	0.812	nucleoplasm
GO:1902494	0.809	catalytic complex
GO:0031982	0.807	vesicle
GO:1903561	0.790	extracellular vesicle
GO:1990234	0.749	transferase complex
GO:0005615	0.732	extracellular space
GO:0070062	0.714	extracellular exosome
GO:0016020	0.704	membrane
GO:0031248	0.664	protein acetyltransferase complex
GO:0031414	0.619	N-terminal protein acetyltransferase complex
GO:0012505	0.329	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.3.1.-	0.994	Transferring groups other than amino-acyl groups.

[back to server]