StarFunc result for job id Q6NSI4

User Input

>input (855 residues)
MSGESGQPEAGPSHAGLDWPNPERNRAGVPGGVIRRAGSQGPRSWIQKVLEQIMDSPRQC
VTPSEVVPVTVLAVQRYLLEDEPRDTVPKPPLYCYDVTISDGVYQEKCYLDPSLNSLVYQ
NILKVGIQMRISRVSCLYNEKRIGQGILCIDNVHCGETSDSISLETPFRNRAHQEKPERP
LRGGKSHYLALWNNEDPYGDIWLTDKQPEEHNFSDTKIISLSHLEMTWTNRRNFPALLVR
ILHKSKLRYYGKPDKKMIEPYQTFLEVADSSGTVSVIMWNALCPEWYKSLRVGLVLLLQD
YSVKKSYPFRIQPVPVDPQIKLISTMEICLNLRDPPTNIIIIPEKQVKPEWRLPKLNHRF
TTRSELDDMPENCICDVIGLLVFVGRVQRSKKKENREDFWSYRWIHIADGTSEQPFIVEL
FSTSQPEIFENIYPMAYFVCTQLKVVRNDNQVPKLLYLTTTNESGVFITGHRGQPYTYDA
KVKNFIQWIRTKSDSGEQKNMVIGGYYPYPPVPETFSKYSSSIKVESLLTAISEVRKEIE
DLQYREQKRIAIQGIITAIKYIPHSSATESASASETLRNANRPSTSQAARVEIQERNGKR
HQDDEPVNSQYFQTTSTNLSLSNKIRILQGPHANPVAVPQPGASVQTKGIKPGMPSIFNR
RANINANLQGKARKTISDRWESQLWREKKFGLIDHLHYSRVYPESIPRKFMFEHRKFLSD
QYNSQPAKYVPPEGRPPKLDDFKSARSLGHFEVTILGLNHEIAIDVAFLPMYCPEDIRTS
QIDTLLTSMNYSCAYPQDTTGNDRLPGPRAVAGDIIKAATELDRVHIVGILDICNLGNNK
VEVYLHKIYSPENTS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6NSI4	1.000	1.000	0.000	855	1.000	1.000	Q6NSI4.pdb.gz	RADX_HUMAN RPA-related protein RADX OS=Homo sapiens OX=9606 GN=RADX PE=1 SV=2
2	AFDB:B1AQ74	0.335	0.501	4.083E-85	566	0.643	0.972	B1AQ74.pdb.gz	B1AQ74_HUMAN RPA1 related single stranded DNA binding protein, X-linked (Fragment) OS=Homo sapiens OX=9606 GN=RADX PE=1 SV=1
3	PDB:8d0bA	0.185	0.147	3.933E-9	1116	0.064	0.049	8d0bA.pdb.gz	Structures of the human CST-Pol alpha-primase complex bound to telomere templates.
4	PDB:2i0qA	0.191	0.315	5.170E-9	461	0.048	0.089	2i0qA.pdb.gz	Structural reorganization and the cooperative binding of single-stranded telomere DNA in Sterkiella nova.
5	AFDB:D0QMC3	0.155	0.221	4.179E-8	538	0.061	0.097	D0QMC3.pdb.gz	MNDAL_MOUSE Myeloid cell nuclear differentiation antigen-like protein OS=Mus musculus OX=10090 GN=Mndal PE=1 SV=1
6	PDB:6w6wA	0.167	0.159	2.375E-7	905	0.076	0.072	6w6wA.pdb.gz	The structure of human CST reveals a decameric assembly bound to telomeric DNA.
7	PDB:7uy5I	0.119	0.164	3.679E-7	528	0.062	0.100	7uy5I.pdb.gz	Structure of Tetrahymena telomerase-bound CST with polymerase alpha-primase.
8	PDB:7uy7A	0.115	0.156	4.335E-7	552	0.065	0.101	7uy7A.pdb.gz	Structure of Tetrahymena telomerase-bound CST with polymerase alpha-primase.
9	PDB:7u5cE	0.185	0.143	5.697E-7	1147	0.067	0.050	7u5cE.pdb.gz	Cryo-EM structure of the human CST-Pol alpha /primase complex in a recruitment state.
10	PDB:7qxbP	0.188	0.512	5.981E-6	251	0.028	0.096	7qxbP.pdb.gz	Structural basis of human telomerase recruitment by TPP1-POT1.
11	PDB:7uy7B	0.117	0.314	3.238E-4	291	0.020	0.058	7uy7B.pdb.gz	Structure of Tetrahymena telomerase-bound CST with polymerase alpha-primase.
12	PDB:4owwB	0.092	0.585	8.664E-4	107	0.021	0.168	4owwB.pdb.gz	Structural Basis of SOSS1 Complex Assembly and Recognition of ssDNA.
13	PDB:6raz2	0.108	0.159	3.590E-3	559	0.032	0.048	6raz2.pdb.gz	Molecular Basis for ATP-Hydrolysis-Driven DNA Translocation by the CMG Helicase of the Eukaryotic Replisome.
14	AFDB:Q8I5T7	0.103	0.080	6.591E-2	1135	0.049	0.037	Q8I5T7.pdb.gz	Q8I5T7_PLAF7 DNA helicase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1211300 PE=3 SV=2
15	AFDB:A0A2R8PZ02	0.055	0.065	6.962E-2	655	0.078	0.102	A0A2R8PZ02.pdb.gz
16	AFDB:A0JNW5	0.062	0.044	1.417E-1	1464	0.095	0.055	A0JNW5.pdb.gz	BLT3B_HUMAN Bridge-like lipid transfer protein family member 3B OS=Homo sapiens OX=9606 GN=BLTP3B PE=1 SV=2
17	AFDB:Q0KI33	0.052	0.048	4.005E-1	1142	0.043	0.032	Q0KI33.pdb.gz	Q0KI33_DROME Uncharacterized protein, isoform F OS=Drosophila melanogaster OX=7227 GN=sp3 PE=1 SV=2
18	AFDB:Q6P9K9	0.060	0.045	5.264E-1	1571	0.062	0.034	Q6P9K9.pdb.gz	NRX3A_MOUSE Neurexin-3 OS=Mus musculus OX=10090 GN=Nrxn3 PE=1 SV=2
19	AFDB:Q99315	0.045	0.030	5.264E-1	1547	0.039	0.021	Q99315.pdb.gz	YG31B_YEAST Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY3B-G PE=1 SV=3
20	AFDB:A1X283	0.059	0.058	1.132	911	0.119	0.112	A1X283.pdb.gz	SPD2B_HUMAN SH3 and PX domain-containing protein 2B OS=Homo sapiens OX=9606 GN=SH3PXD2B PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B1AQ74	0.0	577	566	0.324	0.489	B1AQ74_HUMAN RPA1 related single stranded DNA binding protein, X-linked (Fragment) OS=Homo sapiens OX=9606 GN=RADX PE=1 SV=1
2	Q6NSI4	0.0	1775	855	1.000	1.000	RADX_HUMAN RPA-related protein RADX OS=Homo sapiens OX=9606 GN=RADX PE=1 SV=2
3	Q65XV7	0.029	40.4	951	0.047	0.042	RFA1C_ORYSJ Replication protein A 70 kDa DNA-binding subunit C OS=Oryza sativa subsp. japonica OX=39947 GN=RPA1C PE=1 SV=1
4	Q9SKI4	0.95	35.4	640	0.044	0.059	RFA1A_ARATH Replication protein A 70 kDa DNA-binding subunit A OS=Arabidopsis thaliana OX=3702 GN=RPA1A PE=1 SV=1
5	Q92372	3.1	33.9	609	0.091	0.128	RFA1_SCHPO Replication factor A protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ssb1 PE=1 SV=1
6	P0DTD1	7.0	33.1	7096	0.025	0.003	R1AB_SARS2 Replicase polyprotein 1ab OS=Severe acute respiratory syndrome coronavirus 2 OX=2697049 GN=rep PE=1 SV=1
7	Q6NVD0	7.1	32.7	3160	0.041	0.011	FREM2_MOUSE FRAS1-related extracellular matrix protein 2 OS=Mus musculus OX=10090 GN=Frem2 PE=1 SV=2
8	P0DTC1	7.3	32.7	4405	0.025	0.005	R1A_SARS2 Replicase polyprotein 1a OS=Severe acute respiratory syndrome coronavirus 2 OX=2697049 PE=1 SV=1
9	A0A3G5BIY8	8.6	32.7	7073	0.026	0.003	A0A3G5BIY8_SARS ORF1ab polyprotein OS=SARS coronavirus Urbani OX=228330 PE=1 SV=1
10	P0C6X7	8.6	32.7	7073	0.026	0.003	R1AB_SARS Replicase polyprotein 1ab OS=Severe acute respiratory syndrome coronavirus OX=694009 GN=rep PE=1 SV=1
11	Q5ZJJ2	9.7	32.3	614	0.048	0.067	RFA1_CHICK Replication protein A 70 kDa DNA-binding subunit OS=Gallus gallus OX=9031 GN=RPA1 PE=2 SV=1
12	P0C6U8	9.9	32.3	4382	0.026	0.005	R1A_SARS Replicase polyprotein 1a OS=Severe acute respiratory syndrome coronavirus OX=694009 GN=1a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09103 BRCA-2_OB1	4.5	18.6	BRCA2, oligonucleotide/oligosaccharide-binding, domain 1
2	PF17244 CDC24_OB3	4.7e+02	11.9	Cell division control protein 24, OB domain 3
3	PF17008 DUF5088	5.2e+02	11.7	Domain of unknown function (DUF5088)
4	PF17659 DUF5521	0	1825.9	Family of unknown function (DUF5521)
5	PF15072 HROB	99	14.4	Homologous recombination OB-fold protein
6	PF16900 REPA_OB_2	30	16.0	Replication protein A OB domain
7	PF01336 tRNA_anti-codon	1.7e+02	13.6	OB-fold nucleic acid binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361628

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000231790	0.748	DNA mismatch repair protein Mlh1
2	9606.ENSP00000430338	0.685	Integrator complex subunit 8
3	9606.ENSP00000264159	0.669	DNA annealing helicase and endonuclease ZRANB3
4	9606.ENSP00000349823	0.658	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1
5	9606.ENSP00000040738	0.629	Biorientation of chromosomes in cell division protein 1-like 1
6	9606.ENSP00000231368	0.622	Leucyl-cystinyl aminopeptidase
7	9606.ENSP00000393795	0.611	Zinc finger protein 512B
8	9606.ENSP00000216106	0.596	HMG domain-containing protein 4
9	9606.ENSP00000307853	0.580	Crossover junction endonuclease MUS81
10	9606.ENSP00000256545	0.568	ER membrane protein complex subunit 7
11	9606.ENSP00000369335	0.556	F-box DNA helicase 1
12	9606.ENSP00000273986	0.554	CDGSH iron-sulfur domain-containing protein 2
13	9606.ENSP00000368017	0.551	Zinc finger C3H1 domain-containing protein
14	9606.ENSP00000372088	0.529	DNA repair protein RAD51 homolog 1
15	9606.ENSP00000261461	0.527	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform
16	9606.ENSP00000351185	0.521	DNA replication ATP-dependent helicase/nuclease DNA2
17	9606.ENSP00000003100	0.505	Lanosterol 14-alpha demethylase
18	9606.ENSP00000275053	0.503	Protein MMS22-like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0003697	1.000	single-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.962	regulation of cellular process
GO:0019222	0.887	regulation of metabolic process
GO:0060255	0.883	regulation of macromolecule metabolic process
GO:0031323	0.877	regulation of cellular metabolic process
GO:0080090	0.870	regulation of primary metabolic process
GO:0051171	0.869	regulation of nitrogen compound metabolic process
GO:0048523	0.854	negative regulation of cellular process
GO:0019219	0.762	regulation of nucleobase-containing compound metabolic process
GO:0045910	0.747	negative regulation of DNA recombination
GO:2001020	0.740	regulation of response to DNA damage stimulus
GO:0009987	0.713	cellular process
GO:0006282	0.701	regulation of DNA repair
GO:0048585	0.695	negative regulation of response to stimulus
GO:2000779	0.690	regulation of double-strand break repair
GO:2001021	0.624	negative regulation of response to DNA damage stimulus
GO:0010569	0.624	regulation of double-strand break repair via homologous recombination
GO:0071704	0.462	organic substance metabolic process
GO:0044238	0.414	primary metabolic process
GO:0044237	0.398	cellular metabolic process
GO:0006807	0.397	nitrogen compound metabolic process
GO:0043170	0.390	macromolecule metabolic process
GO:1901360	0.357	organic cyclic compound metabolic process
GO:0044260	0.357	cellular macromolecule metabolic process
GO:0006259	0.316	DNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0016607	0.998	nuclear speck
GO:0005694	0.994	chromosome
GO:0032991	0.949	protein-containing complex
GO:0005657	0.939	replication fork
GO:0005737	0.423	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]