StarFunc result for job id Q6NSI8

User Input

>input (718 residues)
MSRGYSENNNFLNNNNQMVLDMILYPLIGIPQTINWETIARLVPGLTPKECAKRFDELKS
SGSSPVDNQYNSLMAAGESPVETLATYIKSSLLDIHGEFQETPVGHDAVSKTGRHSIAST
RNCSSESENCTTHNGGEMTEESEGPNMVIHVCDEAKNLKEDFTCPRDLLISEMKYFAEYL
SMDAQRWEEVDISVHCDVHIFNWLIKYIKRNTKENKDCEMPTLEPGNVISILISSEFLKM
DSLVEQCIQYCHKNMNAIVATPCNMNCINANLLTRIADLFSHNEVDDLKDKKDKFKSKLF
CKKIERLFDPEYLNPDSRSNAATLYRCCLCKKLLTKETERRIPCIPGKINVDRRGNIVYI
HIRDKTWDVHEYLNSLFEELKSWRDVYWRLWGTINWLTCSRCYQAFLCIEFSHCQYHSET
VVYPTAASSLNTVGTGIYPCCNQKVLRFDPTQLTKGCKVRDHMVTLRDQGEGGDLPSCPT
ARMLDDLHKYRDVIVVPFSKDTVSDVGVGLCDEKGIECDVLLEPNTPWGPKTGELNAFLS
LKNWTLQLKQQSLFSEEEEYTTGSEVTEDEVGDEEEVSKKQRKKEKPKKFTRQPKKQVSS
PCAQRKEKALEKSASRDVSPFVMSMQKNKWDATRSLRFNQDAQREDDQRRMTEITGHLIK
MRLGDLDRVKSKEAKEFAGGIYSRLEAQIKASVPVSARQSSSEKNTRSKSRFGQGRPA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q68FF0	0.546	0.546	2.183E-101	718	0.884	0.884	Q68FF0.pdb.gz	SANBR_MOUSE SANT and BTB domain regulator of class switch recombination OS=Mus musculus OX=10090 GN=Sanbr PE=1 SV=2
2	PDB:6wcqC	0.127	0.634	1.408E-2	130	0.019	0.108	6wcqC.pdb.gz
3	AFDB:Q8CHB8	0.076	0.055	4.503E-2	1328	0.148	0.080	Q8CHB8.pdb.gz	TTLL5_MOUSE Tubulin polyglutamylase TTLL5 OS=Mus musculus OX=10090 GN=Ttll5 PE=1 SV=3
4	AFDB:Q6EMB2	0.070	0.049	5.311E-2	1281	0.118	0.066	Q6EMB2.pdb.gz	TTLL5_HUMAN Tubulin polyglutamylase TTLL5 OS=Homo sapiens OX=9606 GN=TTLL5 PE=1 SV=3
5	AFDB:Q5U127	0.058	0.054	1.212E-1	792	0.123	0.111	Q5U127.pdb.gz	Q5U127_DROME Decapping protein 2, isoform E OS=Drosophila melanogaster OX=7227 GN=DCP2 PE=2 SV=1
6	AFDB:B9F1C0	0.060	0.040	2.477E-1	1709	0.139	0.059	B9F1C0.pdb.gz	SHOC1_ORYSJ Protein SHORTAGE IN CHIASMATA 1 homolog OS=Oryza sativa subsp. japonica OX=39947 GN=SHOC1 PE=1 SV=1
7	AFDB:Q9C5H4	0.075	0.076	2.477E-1	690	0.114	0.119	Q9C5H4.pdb.gz	MTV1_ARATH Protein MODIFIED TRANSPORT TO THE VACUOLE 1 OS=Arabidopsis thaliana OX=3702 GN=MTV1 PE=1 SV=1
8	AFDB:Q9U6M6	0.058	0.058	2.921E-1	751	0.111	0.107	Q9U6M6.pdb.gz	Q9U6M6_DORPE Clathrin assembly protein AP180 OS=Doryteuthis pealeii OX=1051067 GN=AP180 PE=2 SV=1
9	AFDB:D5LMF5	0.067	0.051	3.087E-1	1165	0.152	0.094	D5LMF5.pdb.gz	D5LMF5_XENLA Protein kinase C-binding protein 1 OS=Xenopus laevis OX=8355 GN=zmynd8.S PE=2 SV=1
10	AFDB:Q8LL04	0.082	0.054	3.640E-1	1241	0.131	0.076	Q8LL04.pdb.gz	CPL3_ARATH RNA polymerase II C-terminal domain phosphatase-like 3 OS=Arabidopsis thaliana OX=3702 GN=CPL3 PE=1 SV=2
11	AFDB:Q9VGZ5	0.062	0.063	4.536E-1	698	0.106	0.109	Q9VGZ5.pdb.gz	CWO_DROME Transcription factor cwo OS=Drosophila melanogaster OX=7227 GN=cwo PE=1 SV=2
12	PDB:3tixA	0.058	0.186	5.307E-1	153	0.026	0.124	3tixA.pdb.gz
13	PDB:5xqmA	0.051	0.252	5.607E-1	90	0.013	0.100	5xqmA.pdb.gz
14	PDB:5ia8A	0.063	0.336	5.924E-1	92	0.011	0.087	5ia8A.pdb.gz
15	PDB:1j0gA	0.043	0.208	8.240E-1	92	0.011	0.087	1j0gA.pdb.gz
16	PDB:6sgaFS	0.109	0.258	8.706E-1	277	0.019	0.051	6sgaFS.pdb.gz	Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.
17	PDB:3dbhI	0.044	0.260	9.719E-1	86	0.010	0.081	3dbhI.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
18	PDB:2cjjA	0.057	0.454	1.027	63	0.019	0.222	2cjjA.pdb.gz
19	PDB:1wz0A	0.039	0.214	1.085	104	0.014	0.096	1wz0A.pdb.gz
20	PDB:4rm8A	0.063	0.100	1.211	368	0.024	0.046	4rm8A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q68FF0	0.0	1276	718	0.886	0.886	SANBR_MOUSE SANT and BTB domain regulator of class switch recombination OS=Mus musculus OX=10090 GN=Sanbr PE=1 SV=2
2	Q383Z9	2.81e-14	78.6	560	0.082	0.105	Q383Z9_TRYB2 SANT and BTB domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.1070 PE=4 SV=1
3	Q99543	0.33	36.6	621	0.028	0.032	DNJC2_HUMAN DnaJ homolog subfamily C member 2 OS=Homo sapiens OX=9606 GN=DNAJC2 PE=1 SV=4
4	Q5TC79	0.46	36.2	503	0.033	0.048	ZBT37_HUMAN Zinc finger and BTB domain-containing protein 37 OS=Homo sapiens OX=9606 GN=ZBTB37 PE=2 SV=1
5	Q7TQ20	0.53	36.2	621	0.026	0.031	DNJC2_RAT DnaJ homolog subfamily C member 2 OS=Rattus norvegicus OX=10116 GN=Dnajc2 PE=1 SV=1
6	P54103	0.58	35.8	621	0.026	0.031	DNJC2_MOUSE DnaJ homolog subfamily C member 2 OS=Mus musculus OX=10090 GN=Dnajc2 PE=1 SV=2
7	Q09726	1.3	34.7	542	0.047	0.063	ATP25_SCHPO ATPase synthesis protein 25, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atp25 PE=3 SV=1
8	Q9UHD1	1.5	34.3	332	0.029	0.063	CHRD1_HUMAN Cysteine and histidine-rich domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CHORDC1 PE=1 SV=2
9	A0A060X6Z0	2.3	33.9	489	0.038	0.055	TY3H_ONCMY Tyrosine 3-monooxygenase OS=Oncorhynchus mykiss OX=8022 GN=th PE=1 SV=2
10	Q9FK45	3.6	33.1	320	0.021	0.047	Q9FK45_ARATH RING/U-box superfamily protein OS=Arabidopsis thaliana OX=3702 GN=MRG7.22 PE=1 SV=1
11	Q8WVZ9	4.7	33.1	684	0.032	0.034	KBTB7_HUMAN Kelch repeat and BTB domain-containing protein 7 OS=Homo sapiens OX=9606 GN=KBTBD7 PE=1 SV=1
12	Q9D1P4	4.7	32.7	331	0.028	0.060	CHRD1_MOUSE Cysteine and histidine-rich domain-containing protein 1 OS=Mus musculus OX=10090 GN=Chordc1 PE=1 SV=1
13	Q0WVV0	5.2	32.7	664	0.036	0.039	PPR31_ARATH Pentatricopeptide repeat-containing protein At1g10910, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At1g10910 PE=2 SV=1
14	P14099	5.8	32.7	921	0.042	0.033	PDE2A_BOVIN cGMP-dependent 3',5'-cyclic phosphodiesterase OS=Bos taurus OX=9913 GN=PDE2A PE=1 SV=2
15	Q9LHS5	8.5	32.0	663	0.021	0.023	Q9LHS5_ARATH Cell division related protein-like OS=Arabidopsis thaliana OX=3702 GN=ATGLSA2 PE=1 SV=1
16	F4J6A8	9.9	32.0	647	0.018	0.020	F4J6A8_ARATH DnaJ and Myb-like DNA-binding domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=ATGLSA1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00651 BTB	3.1e+02	13.0	BTB/POZ domain
2	PF00249 Myb_DNA-binding	11	17.7	Myb-like DNA-binding domain
3	PF11822 SANBR_BTB	2.2e-33	125.6	SANT and BTB domain regulator of CSR, BTB domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000385579

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000402915	0.875	Uncharacterized protein C2orf74
2	9606.ENSP00000453273	0.701	Leucine-rich repeat-containing protein 49
3	9606.ENSP00000266254	0.695	Probable tubulin polyglutamylase TTLL1
4	9606.ENSP00000273598	0.681	Nicolin-1
5	9606.ENSP00000288078	0.628	L-fucose kinase
6	9606.ENSP00000371036	0.603	Signal regulatory protein delta
7	9606.ENSP00000305442	0.552	Conserved oligomeric Golgi complex subunit 7
8	9606.ENSP00000345808	0.540	Rho GTPase-activating protein 12
9	9606.ENSP00000309330	0.528	Zinc finger protein 680
10	9606.ENSP00000357545	0.524	Protein FAM162B
11	9606.ENSP00000357565	0.521	Zinc finger with UFM1-specific peptidase domain
12	9606.ENSP00000377970	0.518	Activator of 90 kDa heat shock protein ATPase homolog 2
13	9606.ENSP00000296776	0.514	Transmembrane protein 174
14	9606.ENSP00000265299	0.505	Probable ubiquitin carboxyl-terminal hydrolase MINDY-4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0071704	0.972	organic substance metabolic process
GO:0044238	0.957	primary metabolic process
GO:0006807	0.957	nitrogen compound metabolic process
GO:0044237	0.937	cellular metabolic process
GO:0046483	0.926	heterocycle metabolic process
GO:0034641	0.925	cellular nitrogen compound metabolic process
GO:0006139	0.923	nucleobase-containing compound metabolic process
GO:0043170	0.839	macromolecule metabolic process
GO:0002520	0.802	immune system development
GO:0006310	0.799	DNA recombination
GO:0002250	0.797	adaptive immune response
GO:0002443	0.796	leukocyte mediated immunity
GO:0002440	0.795	production of molecular mediator of immune response
GO:0002263	0.795	cell activation involved in immune response
GO:0046649	0.794	lymphocyte activation
GO:0002377	0.787	immunoglobulin production
GO:0002562	0.787	somatic diversification of immune receptors via germline recombination within a single locus
GO:0002460	0.626	adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0042113	0.625	B cell activation
GO:0002285	0.625	lymphocyte activation involved in immune response
GO:0002449	0.624	lymphocyte mediated immunity
GO:0019724	0.609	B cell mediated immunity
GO:0002312	0.608	B cell activation involved in immune response
GO:0016064	0.537	immunoglobulin mediated immune response
GO:0065007	0.379	biological regulation
GO:0050789	0.362	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	0.999	organelle
GO:0005737	0.999	cytoplasm
GO:0043229	0.993	intracellular organelle
GO:0043231	0.967	intracellular membrane-bounded organelle
GO:0005634	0.959	nucleus
GO:0070013	0.910	intracellular organelle lumen
GO:0031981	0.750	nuclear lumen
GO:0005829	0.475	cytosol
GO:0005654	0.345	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]