StarFunc result for job id Q6NSW5

User Input

>input (357 residues)
MAAAELADTQLMLGVGLIEKDTNGEVLWVWCYPSTTATLRNLLLRKCCLTDENKLLHPFV
FGQYRRTWFYITIIEVPDSSILKKVTHFSIVLTAKDFNPEKYAAFTRILCRMYLKHGSPV
KMMESYIAVLTKGICQSEENGSFLSKDFDARKAYPAGSIKDIVSQFGMETVILHTALMLK
KRIVVYHPKIEAVQEFTRTLPALVWHRQDWTILHSYVHLNADELEALQMCTGYVAGFVDL
EVSNRPDLYDVFVNLAESEITIAPLAKEAMAMGKLHKEMGQLIVQSAEDPEKSESQVIQD
IALKTREIFTNLAPFSEVSADGEKRVLNLEALKQKRFPPATENFLYHLAAAEQMLKI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TCE6	0.994	0.994	5.938E-65	357	0.989	0.989	Q8TCE6.pdb.gz	DEN10_HUMAN DENN domain-containing protein 10 OS=Homo sapiens OX=9606 GN=DENND10 PE=1 SV=1
2	AFDB:O13943	0.644	0.509	1.493E-12	469	0.182	0.139	O13943.pdb.gz	AVL9_SCHPO Late secretory pathway protein avl9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=avl9 PE=3 SV=2
3	AFDB:Q68D51	0.683	0.301	2.461E-11	928	0.148	0.057	Q68D51.pdb.gz	DEN2C_HUMAN DENN domain-containing protein 2C OS=Homo sapiens OX=9606 GN=DENND2C PE=1 SV=2
4	AFDB:P78524	0.639	0.240	3.401E-11	1137	0.129	0.040	P78524.pdb.gz	DEN2B_HUMAN DENN domain-containing protein 2B OS=Homo sapiens OX=9606 GN=DENND2B PE=1 SV=3
5	AFDB:Q9ULE3	0.652	0.268	3.589E-11	1009	0.148	0.053	Q9ULE3.pdb.gz	DEN2A_HUMAN DENN domain-containing protein 2A OS=Homo sapiens OX=9606 GN=DENND2A PE=1 SV=4
6	AFDB:Q12500	0.612	0.322	5.234E-11	764	0.165	0.077	Q12500.pdb.gz	AVL9_YEAST Late secretory pathway protein AVL9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AVL9 PE=1 SV=1
7	AFDB:Q9H6A0	0.642	0.511	7.632E-11	471	0.120	0.091	Q9H6A0.pdb.gz	DEN2D_HUMAN DENN domain-containing protein 2D OS=Homo sapiens OX=9606 GN=DENND2D PE=1 SV=2
8	AFDB:Q86WG5	0.647	0.151	5.605E-10	1849	0.162	0.031	Q86WG5.pdb.gz	MTMRD_HUMAN Myotubularin-related protein 13 OS=Homo sapiens OX=9606 GN=SBF2 PE=1 SV=1
9	AFDB:Q3U1T9	0.653	0.335	1.070E-9	766	0.109	0.051	Q3U1T9.pdb.gz	DEN1B_MOUSE DENN domain-containing protein 1B OS=Mus musculus OX=10090 GN=Dennd1b PE=1 SV=3
10	AFDB:O42907	0.555	0.455	1.192E-9	448	0.134	0.107	O42907.pdb.gz	YBAG_SCHPO Uncharacterized protein C119.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC119.16c PE=4 SV=1
11	PDB:6nzdH	0.301	0.283	5.142E-7	387	0.146	0.134	6nzdH.pdb.gz	Structural mechanism of a Rag GTPase activation checkpoint by the lysosomal folliculin complex.
12	PDB:7mgeC	0.347	0.342	6.044E-7	365	0.120	0.118	7mgeC.pdb.gz	Structural basis for the ARF GAP activity and specificity of the C9orf72 complex.
13	PDB:8dhbJ	0.322	0.319	7.498E-7	361	0.123	0.122	8dhbJ.pdb.gz	Structural basis for FLCN RagC GAP activation in MiT-TFE substrate-selective mTORC1 regulation.
14	PDB:6lt0C	0.351	0.331	2.359E-5	385	0.112	0.104	6lt0C.pdb.gz
15	PDB:6ulgL	0.366	0.295	2.628E-5	458	0.115	0.090	6ulgL.pdb.gz	Cryo-EM Structure of the Human FLCN-FNIP2-Rag-Ragulator Complex.
16	PDB:6ulgN	0.234	0.179	2.927E-5	483	0.115	0.085	6ulgN.pdb.gz	Cryo-EM Structure of the Human FLCN-FNIP2-Rag-Ragulator Complex.
17	PDB:6nzdI	0.302	0.284	1.011E-4	388	0.109	0.101	6nzdI.pdb.gz	Structural mechanism of a Rag GTPase activation checkpoint by the lysosomal folliculin complex.
18	PDB:6lt0B	0.334	0.312	5.984E-4	386	0.118	0.109	6lt0B.pdb.gz
19	PDB:7o2wA	0.349	0.310	7.834E-4	418	0.118	0.100	7o2wA.pdb.gz
20	PDB:7t3aC	0.230	0.205	5.166E-3	406	0.036	0.032	7t3aC.pdb.gz	Cryo-EM structures of the human GATOR1-Rag-Ragulator complex reveal a spatial-constraint regulated GAP mechanism.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8TCE6	0.0	736	357	0.989	0.989	DEN10_HUMAN DENN domain-containing protein 10 OS=Homo sapiens OX=9606 GN=DENND10 PE=1 SV=1
2	P38302	0.29	34.3	140	0.073	0.186	NTC20_YEAST Pre-mRNA-splicing factor NTC20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NTC20 PE=1 SV=1
3	O14558	2.3	31.6	160	0.056	0.125	HSPB6_HUMAN Heat shock protein beta-6 OS=Homo sapiens OX=9606 GN=HSPB6 PE=1 SV=2
4	V9HWB6	2.3	31.6	160	0.056	0.125	V9HWB6_HUMAN Epididymis luminal protein 55 OS=Homo sapiens OX=9606 GN=HEL55 PE=2 SV=1
5	Q7F1K9	2.5	32.3	309	0.104	0.120	UGHY_ORYSJ Probable (S)-ureidoglycine aminohydrolase OS=Oryza sativa subsp. japonica OX=39947 GN=UGLYAH PE=1 SV=1
6	Q5BGR2	5.0	31.6	791	0.034	0.015	MESA_EMENI Protein mesA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mesA PE=1 SV=2
7	A0QNK4	6.5	31.2	520	0.050	0.035	A0QNK4_MYCS2 Antigen MTB48 OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=MSMEG_0076 PE=1 SV=1
8	P40749	7.7	30.8	425	0.056	0.047	SYT4_MOUSE Synaptotagmin-4 OS=Mus musculus OX=10090 GN=Syt4 PE=1 SV=2
9	P50232	7.8	30.8	425	0.056	0.047	SYT4_RAT Synaptotagmin-4 OS=Rattus norvegicus OX=10116 GN=Syt4 PE=1 SV=1
10	Q4WVN4	8.3	31.2	8515	0.078	0.003	NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=NRPS8 PE=3 SV=1
11	O75882	8.6	31.2	1429	0.050	0.013	ATRN_HUMAN Attractin OS=Homo sapiens OX=9606 GN=ATRN PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09794 Avl9	2.4e-05	34.8	Transport protein Avl9
2	PF09804 DENND11	0.022	25.9	DENN domain-containing protein 11
3	PF08616 SPA	1.2e-05	36.6	Stabilization of polarity axis

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354688

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000365401	0.944	Coiled-coil domain-containing protein 22
2	9606.ENSP00000394331	0.934	COMM domain-containing protein 5
3	9606.ENSP00000365477	0.929	Coiled-coil domain-containing protein 93
4	9606.ENSP00000366032	0.913	COMM domain-containing protein 3
5	9606.ENSP00000311401	0.910	Protein DENND6A
6	9606.ENSP00000315568	0.909	Late secretory pathway protein AVL9 homolog
7	9606.ENSP00000445768	0.909	Protein LCHN
8	9606.ENSP00000311399	0.907	Down syndrome critical region gene 3
9	9606.ENSP00000267935	0.882	COMM domain-containing protein 4
10	9606.ENSP00000480853	0.851	Vacuolar protein sorting-associated protein 29
11	9606.ENSP00000251143	0.839	UPF0505 protein C16orf62
12	9606.ENSP00000419475	0.834	COMM domain-containing protein 2
13	9606.ENSP00000263401	0.824	COMM domain-containing protein 9
14	9606.ENSP00000370984	0.805	COMM domain-containing protein 8
15	9606.ENSP00000274458	0.767	COMM domain-containing protein 10
16	9606.ENSP00000348054	0.764	COMM domain containing 6
17	9606.ENSP00000278025	0.761	Fucose mutarotase
18	9606.ENSP00000278980	0.750	COMM domain-containing protein 7
19	9606.ENSP00000308236	0.722	COMM domain-containing protein 1
20	9606.ENSP00000392985	0.722	Oxidoreductase HTATIP2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031267	1.000	small GTPase binding
GO:0005085	1.000	guanyl-nucleotide exchange factor activity
GO:0003824	0.357	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0016197	0.993	endosomal transport
GO:0050794	0.985	regulation of cellular process
GO:0060341	0.982	regulation of cellular localization
GO:0032386	0.961	regulation of intracellular transport
GO:0008104	0.959	protein localization
GO:0032509	0.926	endosome transport via multivesicular body sorting pathway
GO:0045184	0.920	establishment of protein localization
GO:0071705	0.908	nitrogen compound transport
GO:0071702	0.905	organic substance transport
GO:1903649	0.867	regulation of cytoplasmic transport
GO:0015031	0.811	protein transport
GO:0060627	0.734	regulation of vesicle-mediated transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005768	0.999	endosome
GO:0005770	0.994	late endosome
GO:0005829	0.820	cytosol
GO:0031974	0.460	membrane-enclosed lumen
GO:0005634	0.398	nucleus
GO:0070013	0.376	intracellular organelle lumen
GO:0031981	0.329	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]