StarFunc result for job id Q6NT76

User Input

>input (420 residues)
MLSSFPVVLLETMSHYTDEPRFTIEQIDLLQRLRRTGMTKHEILHALETLDRLDQEHSDK
FGRRSSYGGSSYGNSTNNVPASSSTATASTQTQHSGMSPSPSNSYDTSPQPCTTNQNGRE
NNERLSTSNGKMSPTRYHANSMGQRSYSFEASEEDLDVDDKVEELMRRDSSVIKEEIKAF
LANRRISQAVVAQVTGISQSRISHWLLQQGSDLSEQKKRAFYRWYQLEKTNPGATLSMRP
APIPIEDPEWRQTPPPVSATSGTFRLRRGSRFTWRKECLAVMESYFNENQYPDEAKREEI
ANACNAVIQKPGKKLSDLERVTSLKVYNWFANRRKEIKRRANIEAAILESHGIDVQSPGG
HSNSDDVDGNDYSEQDDSTSHSDHQDPISLAVEMAAVNHTILALARQGANEIKTEALDDD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6NT76	1.000	1.000	9.204E-60	420	1.000	1.000	Q6NT76.pdb.gz	HMBX1_HUMAN Homeobox-containing protein 1 OS=Homo sapiens OX=9606 GN=HMBOX1 PE=1 SV=1
2	AFDB:H0YLF2	0.322	0.366	4.428E-42	364	0.814	0.940	H0YLF2.pdb.gz	H0YLF2_HUMAN Homeobox containing 1 (Fragment) OS=Homo sapiens OX=9606 GN=HMBOX1 PE=1 SV=8
3	AFDB:Q9TYT0	0.228	0.226	2.981E-11	424	0.224	0.222	Q9TYT0.pdb.gz	HMBX1_CAEEL Homeobox-containing protein 1 OS=Caenorhabditis elegans OX=6239 GN=hmbx-1 PE=1 SV=1
4	AFDB:Q8UW00	0.189	0.155	1.436E-9	532	0.188	0.148	Q8UW00.pdb.gz	HN1BB_DANRE Hepatocyte nuclear factor 1-beta-B OS=Danio rerio OX=7955 GN=hnf1bb PE=2 SV=1
5	AFDB:E0YMJ6	0.202	0.165	2.518E-9	531	0.198	0.156	E0YMJ6.pdb.gz	E0YMJ6_HUMAN HNF1 beta A splice variant 1 OS=Homo sapiens OX=9606 GN=HNF1B PE=2 SV=1
6	AFDB:A1L1N5	0.207	0.161	6.541E-9	559	0.205	0.154	A1L1N5.pdb.gz	HN1BA_DANRE Hepatocyte nuclear factor 1-beta-A OS=Danio rerio OX=7955 GN=hnf1ba PE=2 SV=2
7	AFDB:P27889	0.208	0.163	1.357E-8	558	0.202	0.152	P27889.pdb.gz	HNF1B_MOUSE Hepatocyte nuclear factor 1-beta OS=Mus musculus OX=10090 GN=Hnf1b PE=1 SV=2
8	AFDB:A0A087WXS2	0.193	0.268	6.918E-7	293	0.152	0.218	A0A087WXS2.pdb.gz	A0A087WXS2_HUMAN Hepatocyte nuclear factor 1-beta OS=Homo sapiens OX=9606 GN=HNF1B PE=4 SV=1
9	AFDB:P53565	0.251	0.089	1.901E-6	1504	0.176	0.049	P53565.pdb.gz	CUX1_RAT Homeobox protein cut-like 1 OS=Rattus norvegicus OX=10116 GN=Cux1 PE=1 SV=2
10	AFDB:P54366	0.208	0.209	5.224E-6	415	0.162	0.164	P54366.pdb.gz	GSC_DROME Homeobox protein goosecoid OS=Drosophila melanogaster OX=7227 GN=Gsc PE=2 SV=2
11	PDB:2hi3A	0.120	0.595	7.792E-2	73	0.043	0.247	2hi3A.pdb.gz
12	PDB:4egcA	0.126	0.107	1.032E-1	539	0.090	0.071	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
13	PDB:3dnvB	0.127	0.624	1.617	71	0.019	0.113	3dnvB.pdb.gz	Molecular mechanisms of HipA-mediated multidrug tolerance and its neutralization by HipB.
14	PDB:1jftA	0.087	0.106	1.914	340	0.019	0.024	1jftA.pdb.gz	Role of residue 147 in the gene regulatory function of the Escherichia coli purine repressor.
15	PDB:7pubCI	0.073	0.072	2.680	427	0.055	0.054	7pubCI.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.
16	PDB:1b0nA	0.116	0.401	2.835	103	0.026	0.107	1b0nA.pdb.gz	An evolutionary link between sporulation and prophage induction in the structure of a repressor:anti-repressor complex.
17	PDB:6cf1B	0.102	0.401	2.835	94	0.040	0.181	6cf1B.pdb.gz
18	PDB:6jcxF	0.065	0.120	2.835	186	0.076	0.172	6jcxF.pdb.gz	Structures and mechanism of transcription initiation by bacterial ECF factors.
19	PDB:4yarA	0.089	0.087	2.999	429	0.040	0.040	4yarA.pdb.gz
20	PDB:5jaaA	0.096	0.331	3.172	102	0.033	0.137	5jaaA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E5RGZ2	0.0	782	386	0.893	0.972	E5RGZ2_HUMAN Homeobox containing 1 OS=Homo sapiens OX=9606 GN=HMBOX1 PE=1 SV=1
2	H0YKJ1	0.0	785	396	0.893	0.947	H0YKJ1_HUMAN Homeobox containing 1 OS=Homo sapiens OX=9606 GN=HMBOX1 PE=1 SV=1
3	H0YLF2	0.0	704	364	0.819	0.945	H0YLF2_HUMAN Homeobox containing 1 (Fragment) OS=Homo sapiens OX=9606 GN=HMBOX1 PE=1 SV=8
4	Q6NT76	0.0	877	420	1.000	1.000	HMBX1_HUMAN Homeobox-containing protein 1 OS=Homo sapiens OX=9606 GN=HMBOX1 PE=1 SV=1
5	Q8BJA3	0.0	862	419	0.988	0.990	HMBX1_MOUSE Homeobox-containing protein 1 OS=Mus musculus OX=10090 GN=Hmbox1 PE=1 SV=1
6	Q9TYT0	3.52e-28	117	424	0.214	0.212	HMBX1_CAEEL Homeobox-containing protein 1 OS=Caenorhabditis elegans OX=6239 GN=hmbx-1 PE=1 SV=1
7	P15257	1.53e-13	74.7	628	0.133	0.089	HNF1A_RAT Hepatocyte nuclear factor 1-alpha OS=Rattus norvegicus OX=10116 GN=Hnf1a PE=1 SV=1
8	P22361	1.81e-13	74.7	628	0.133	0.089	HNF1A_MOUSE Hepatocyte nuclear factor 1-alpha OS=Mus musculus OX=10090 GN=Hnf1a PE=1 SV=2
9	P20823	2.27e-13	74.3	631	0.133	0.089	HNF1A_HUMAN Hepatocyte nuclear factor 1-alpha OS=Homo sapiens OX=9606 GN=HNF1A PE=1 SV=2
10	A1L1N5	3.08e-13	73.6	559	0.207	0.156	HN1BA_DANRE Hepatocyte nuclear factor 1-beta-A OS=Danio rerio OX=7955 GN=hnf1ba PE=2 SV=2
11	Q8UVH4	5.81e-13	72.8	560	0.121	0.091	Q8UVH4_DANRE HNF1 homeobox a OS=Danio rerio OX=7955 GN=tcf1 PE=2 SV=1
12	A0A0C4DGS8	6.31e-12	69.3	457	0.162	0.149	A0A0C4DGS8_HUMAN HNF1 homeobox B OS=Homo sapiens OX=9606 GN=HNF1B PE=1 SV=1
13	E0YMJ6	6.96e-12	69.3	531	0.162	0.128	E0YMJ6_HUMAN HNF1 beta A splice variant 1 OS=Homo sapiens OX=9606 GN=HNF1B PE=2 SV=1
14	A0A087WZC2	9.53e-11	65.9	548	0.169	0.130	A0A087WZC2_HUMAN HNF1 homeobox B OS=Homo sapiens OX=9606 GN=HNF1B PE=1 SV=1
15	P35680	1.36e-10	65.5	557	0.169	0.127	HNF1B_HUMAN Hepatocyte nuclear factor 1-beta OS=Homo sapiens OX=9606 GN=HNF1B PE=1 SV=1
16	Q6FHW6	1.36e-10	65.5	557	0.169	0.127	Q6FHW6_HUMAN TCF2 protein OS=Homo sapiens OX=9606 GN=TCF2 PE=2 SV=1
17	P27889	1.53e-10	65.1	558	0.145	0.109	HNF1B_MOUSE Hepatocyte nuclear factor 1-beta OS=Mus musculus OX=10090 GN=Hnf1b PE=1 SV=2
18	P23899	1.91e-10	65.1	557	0.143	0.108	HNF1B_RAT Hepatocyte nuclear factor 1-beta OS=Rattus norvegicus OX=10116 GN=Hnf1b PE=1 SV=1
19	E0YMJ8	2.02e-10	64.7	425	0.140	0.139	E0YMJ8_HUMAN HNF1 beta A splice variant 3 OS=Homo sapiens OX=9606 GN=HNF1B PE=1 SV=1
20	Q8UW00	4.54e-10	63.9	532	0.212	0.167	HN1BB_DANRE Hepatocyte nuclear factor 1-beta-B OS=Danio rerio OX=7955 GN=hnf1bb PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18860 AbiJ_NTD3	30	15.5	AbiJ N-terminal domain 3
2	PF02376 CUT	2.4e+02	13.2	CUT domain
3	PF04361 DUF494	71	14.7	Protein of unknown function (DUF494)
4	PF04814 HNF-1_N	1.4e-60	216.5	Hepatocyte nuclear factor 1 (HNF-1), N terminus
5	PF05920 Homeobox_KN	0.086	24.1	Homeobox KN domain
6	PF00046 Homeodomain	1.2e-06	39.5	Homeodomain
7	PF13384 HTH_23	4.8e+02	12.1	Homeodomain-like domain
8	PF13412 HTH_24	51	14.9	Winged helix-turn-helix DNA-binding
9	PF01381 HTH_3	11	17.4	Helix-turn-helix
10	PF13560 HTH_31	1.8e+02	13.9	Helix-turn-helix domain
11	PF13744 HTH_37	2.7	19.3	Helix-turn-helix domain
12	PF13411 MerR_1	1.3e+02	14.1	MerR HTH family regulatory protein
13	PF07540 NOC3p	2.6e+02	13.4	Nucleolar complex-associated protein
14	PF15943 YdaS_antitoxin	8.1e+02	11.5	Putative antitoxin of bacterial toxin-antitoxin system, YdaS/YdaT

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000020282

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000007232	0.644	ATPase, class VI, type 11B
2	61853.ENSNLEP00000003803	0.560	Fibrinogen silencer binding protein
3	61853.ENSNLEP00000012283	0.559	Serine peptidase inhibitor, Kazal type 7 (putative)
4	61853.ENSNLEP00000020507	0.551	S1 RNA binding domain 1
5	61853.ENSNLEP00000005656	0.542	Homeodomain interacting protein kinase 1
6	61853.ENSNLEP00000010485	0.537	Zinc finger and BTB domain containing 48
7	61853.ENSNLEP00000019110	0.532	Zinc finger protein 276
8	61853.ENSNLEP00000006746	0.528	Zinc finger protein 827
9	61853.ENSNLEP00000016699	0.521	H2.0-like homeobox

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	1.000	protein-containing complex binding
GO:0005515	1.000	protein binding
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0003691	0.996	double-stranded telomeric DNA binding
GO:0042802	0.988	identical protein binding
GO:0140110	0.474	transcription regulator activity
GO:0003700	0.453	DNA-binding transcription factor activity
GO:0000976	0.353	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0050794	0.982	regulation of cellular process
GO:0060255	0.960	regulation of macromolecule metabolic process
GO:0019219	0.957	regulation of nucleobase-containing compound metabolic process
GO:0009889	0.940	regulation of biosynthetic process
GO:0010556	0.926	regulation of macromolecule biosynthetic process
GO:0031326	0.926	regulation of cellular biosynthetic process
GO:0044093	0.911	positive regulation of molecular function
GO:0051052	0.897	regulation of DNA metabolic process
GO:0010468	0.872	regulation of gene expression
GO:0048522	0.849	positive regulation of cellular process
GO:0051252	0.845	regulation of RNA metabolic process
GO:2001141	0.840	regulation of RNA biosynthetic process
GO:0010604	0.837	positive regulation of macromolecule metabolic process
GO:0033044	0.829	regulation of chromosome organization
GO:0006355	0.828	regulation of DNA-templated transcription
GO:0051173	0.825	positive regulation of nitrogen compound metabolic process
GO:0031325	0.825	positive regulation of cellular metabolic process
GO:0045935	0.817	positive regulation of nucleobase-containing compound metabolic process
GO:0010557	0.797	positive regulation of macromolecule biosynthetic process
GO:0031328	0.792	positive regulation of cellular biosynthetic process
GO:0032204	0.787	regulation of telomere maintenance
GO:0051098	0.713	regulation of binding
GO:0050790	0.680	regulation of catalytic activity
GO:0010605	0.670	negative regulation of macromolecule metabolic process
GO:2000278	0.650	regulation of DNA biosynthetic process
GO:0045934	0.644	negative regulation of nucleobase-containing compound metabolic process
GO:0009987	0.625	cellular process
GO:0006357	0.613	regulation of transcription by RNA polymerase II
GO:1904356	0.597	regulation of telomere maintenance via telomere lengthening
GO:0010558	0.423	negative regulation of macromolecule biosynthetic process
GO:0031327	0.421	negative regulation of cellular biosynthetic process
GO:0032210	0.367	regulation of telomere maintenance via telomerase
GO:0071704	0.341	organic substance metabolic process
GO:0051054	0.306	positive regulation of DNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0016604	0.999	nuclear body
GO:0005829	0.998	cytosol
GO:0005813	0.987	centrosome
GO:0000781	0.983	chromosome, telomeric region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]