StarFunc result for job id Q6NTE8

User Input

>input (343 residues)
MASLQRSRVLRCCSCRLFQAHQVKKSVKWTCKACGEKQSFLQAYGEGSGADCRRHVQKLN
LLQGQVSELPLRSLEETVSASEEENVGHQQAGNVKQQEKSQPSESRWLKYLEKDSQELEL
EGTGVCFSKQPSSKMEEPGPRFSQDLPRKRKWSRSTVQPPCSRGVQDSGGSEVAWGPQKG
QAGLTWKVKQGSSPCLQENSADCSAGELRGPGKELWSPIQQVTATSSKWAQFVLPPRKSS
HVDSEQPRSLQRDPRPAGPAQAKQGTPRAQASREGLSRPTAAVQLPRATHPVTSGSERPC
GKTSWDARTPWAEGGPLVLEAQNPRPTRLCDLFITGEDFDDDV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6NTE8	0.999	0.999	2.053E-51	343	1.000	1.000	Q6NTE8.pdb.gz	MRNIP_HUMAN MRN complex-interacting protein OS=Homo sapiens OX=9606 GN=MRNIP PE=1 SV=2
2	AFDB:O82277	0.078	0.075	8.451E-1	361	0.125	0.119	O82277.pdb.gz	TCP10_ARATH Transcription factor TCP10 OS=Arabidopsis thaliana OX=3702 GN=TCP10 PE=1 SV=1
3	PDB:6hivBe	0.098	0.295	1.202	101	0.026	0.089	6hivBe.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
4	PDB:2gpfA	0.121	0.488	1.365	72	0.017	0.083	2gpfA.pdb.gz
5	AFDB:Q9Z0Y8	0.090	0.021	1.806	2201	0.149	0.023	Q9Z0Y8.pdb.gz	CAC1I_RAT Voltage-dependent T-type calcium channel subunit alpha-1I OS=Rattus norvegicus OX=10116 GN=Cacna1i PE=1 SV=3
6	PDB:5apnp	0.075	0.245	1.872	91	0.038	0.143	5apnp.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
7	PDB:5ja1B	0.104	0.417	2.264	66	0.023	0.121	5ja1B.pdb.gz	Structures of a Nonribosomal Peptide Synthetase Module Bound to MbtH-like Proteins Support a Highly Dynamic Domain Architecture.
8	PDB:5n5yI	0.083	0.225	2.412	99	0.015	0.051	5n5yI.pdb.gz	Structural Basis of RNA Polymerase I Transcription Initiation.
9	AFDB:P08018	0.111	0.062	2.639	668	0.102	0.052	P08018.pdb.gz	PBS2_YEAST MAP kinase kinase PBS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PBS2 PE=1 SV=4
10	AFDB:Q9R037	0.106	0.046	2.812	908	0.166	0.063	Q9R037.pdb.gz	WDR44_RAT WD repeat-containing protein 44 OS=Rattus norvegicus OX=10116 GN=Wdr44 PE=1 SV=1
11	PDB:5k16B	0.082	0.084	2.916	328	0.023	0.024	5k16B.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
12	AFDB:Q38C20	0.100	0.066	3.191	588	0.128	0.075	Q38C20.pdb.gz	Q38C20_TRYB2 NTF2 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.5500 PE=4 SV=1
13	PDB:6ahrK	0.066	0.131	3.309	121	0.047	0.132	6ahrK.pdb.gz	Cryo-EM Structure of the Human Ribonuclease P Holoenzyme.
14	PDB:8d0kF	0.081	0.040	3.309	915	0.026	0.010	8d0kF.pdb.gz	Structures of the human CST-Pol alpha-primase complex bound to telomere templates.
15	AFDB:A1Z898	0.081	0.040	3.622	747	0.160	0.074	A1Z898.pdb.gz	A1Z898_DROME Chromatin assembly factor 1, p105 subunit OS=Drosophila melanogaster OX=7227 GN=Caf1-105 PE=1 SV=1
16	PDB:7d58L	0.086	0.447	3.755	47	0.017	0.128	7d58L.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.
17	PDB:7a1gf	0.092	0.282	4.001	81	0.023	0.099	7a1gf.pdb.gz	A structural inventory of native ribosomal ABCE1-43S pre-initiation complexes.
18	AFDB:Q55CW4	0.084	0.081	4.110	364	0.090	0.085	Q55CW4.pdb.gz	Q55CW4_DICDI SH3 domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0269874 PE=4 SV=1
19	AFDB:B3DHL7	0.120	0.059	4.378	790	0.137	0.059	B3DHL7.pdb.gz	B3DHL7_DANRE Kirre like nephrin family adhesion molecule 1b precursor OS=Danio rerio OX=7955 GN=si:ch211-195h23.2 PE=2 SV=1
20	AFDB:Q8IZP0	0.081	0.061	5.294	508	0.152	0.102	Q8IZP0.pdb.gz	ABI1_HUMAN Abl interactor 1 OS=Homo sapiens OX=9606 GN=ABI1 PE=1 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6NTE8	0.0	691	343	1.000	1.000	MRNIP_HUMAN MRN complex-interacting protein OS=Homo sapiens OX=9606 GN=MRNIP PE=1 SV=2
2	Q2LAE1	3.0	32.3	1759	0.067	0.013	ASHH2_ARATH Histone-lysine N-methyltransferase ASHH2 OS=Arabidopsis thaliana OX=3702 GN=ASHH2 PE=1 SV=1
3	P15926	3.8	32.0	1167	0.070	0.021	C5AP_STRPY C5a peptidase OS=Streptococcus pyogenes OX=1314 GN=scpA PE=1 SV=1
4	F4IXI9	4.1	32.0	1192	0.096	0.028	F4IXI9_ARATH Dentin sialophosphoprotein-like protein OS=Arabidopsis thaliana OX=3702 GN=MXL8.16 PE=1 SV=1
5	A0A0B4K6B1	9.6	30.8	2792	0.076	0.009	A0A0B4K6B1_DROME Rab3 interacting molecule, isoform P OS=Drosophila melanogaster OX=7227 GN=Rim PE=4 SV=1
6	A0A0B4K6M2	9.8	30.8	2798	0.076	0.009	A0A0B4K6M2_DROME Rab3 interacting molecule, isoform F OS=Drosophila melanogaster OX=7227 GN=Rim PE=4 SV=1
7	P09603	9.8	30.4	554	0.093	0.058	CSF1_HUMAN Macrophage colony-stimulating factor 1 OS=Homo sapiens OX=9606 GN=CSF1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05839 Apc13p	5.5e+02	12.2	Apc13p protein
2	PF15749 MRNIP	2.4e-26	103.9	MRN-interacting protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000292586

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000482374	0.630	Proline-rich protein 36
2	9606.ENSP00000354204	0.603	TOMM20-like protein 1
3	9606.ENSP00000442291	0.603	IQ motif containing C
4	9606.ENSP00000302310	0.556	Zinc finger protein 396
5	9606.ENSP00000294304	0.526	Low-density lipoprotein receptor-related protein 5
6	9606.ENSP00000482378	0.526	Low-density lipoprotein receptor-related protein 5-like protein
7	9606.ENSP00000299575	0.517	ATM interactor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003682	1.000	chromatin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0050794	0.979	regulation of cellular process
GO:0031325	0.968	positive regulation of cellular metabolic process
GO:0051173	0.967	positive regulation of nitrogen compound metabolic process
GO:0010604	0.963	positive regulation of macromolecule metabolic process
GO:0051641	0.962	cellular localization
GO:0019219	0.941	regulation of nucleobase-containing compound metabolic process
GO:0048523	0.935	negative regulation of cellular process
GO:0010564	0.905	regulation of cell cycle process
GO:0019220	0.900	regulation of phosphate metabolic process
GO:0033365	0.881	protein localization to organelle
GO:0051338	0.880	regulation of transferase activity
GO:0001932	0.876	regulation of protein phosphorylation
GO:0045859	0.873	regulation of protein kinase activity
GO:0045935	0.858	positive regulation of nucleobase-containing compound metabolic process
GO:0007165	0.842	signal transduction
GO:0048583	0.827	regulation of response to stimulus
GO:0010948	0.795	negative regulation of cell cycle process
GO:0034502	0.763	protein localization to chromosome
GO:0007346	0.741	regulation of mitotic cell cycle
GO:1903047	0.740	mitotic cell cycle process
GO:0051247	0.715	positive regulation of protein metabolic process
GO:0071168	0.711	protein localization to chromatin
GO:0048584	0.708	positive regulation of response to stimulus
GO:0006974	0.695	cellular response to DNA damage stimulus
GO:0006282	0.688	regulation of DNA repair
GO:0044818	0.688	mitotic G2/M transition checkpoint
GO:0044773	0.688	mitotic DNA damage checkpoint signaling
GO:2001022	0.682	positive regulation of response to DNA damage stimulus
GO:0000018	0.682	regulation of DNA recombination
GO:0007095	0.682	mitotic G2 DNA damage checkpoint signaling
GO:0045860	0.675	positive regulation of protein kinase activity
GO:0009314	0.642	response to radiation
GO:0051054	0.579	positive regulation of DNA metabolic process
GO:2000781	0.563	positive regulation of double-strand break repair
GO:0010212	0.527	response to ionizing radiation
GO:0045911	0.527	positive regulation of DNA recombination
GO:0010569	0.526	regulation of double-strand break repair via homologous recombination
GO:0071704	0.307	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0140513	0.999	nuclear protein-containing complex
GO:0005737	0.756	cytoplasm
GO:0030870	0.754	Mre11 complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]