StarFunc result for job id Q6NUI2

User Input

>input (795 residues)
MATMLEGRCQTQPRSSPSGREASLWSSGFGMKLEAVTPFLGKYRPFVGRCCQTCTPKSWE
SLFHRSITDLGFCNVILVKEENTRFRGWLVRRLCYFLWSLEQHIPPCQDVPQKIMESTGV
QNLLSGRVPGGTGEGQVPDLVKKEVQRILGHIQAPPRPFLVRLFSWALLRFLNCLFLNVQ
LHKGQMKMVQKAAQAGLPLVLLSTHKTLLDGILLPFMLLSQGLGVLRVAWDSRACSPALR
ALLRKLGGLFLPPEASLSLDSSEGLLARAVVQAVIEQLLVSGQPLLIFLEEPPGALGPRL
SALGQAWVGFVVQAVQVGIVPDALLVPVAVTYDLVPDAPCDIDHASAPLGLWTGALAVLR
SLWSRWGCSHRICSRVHLAQPFSLQEYIVSARSCWGGRQTLEQLLQPIVLGQCTAVPDTE
KEQEWTPITGPLLALKEEDQLLVRRLSCHVLSASVGSSAVMSTAIMATLLLFKHQKLLGE
FSWLTEEILLRGFDVGFSGQLRSLLQHSLSLLRAHVALLRIRQGDLLVVPQPGPGLTHLA
QLSAELLPVFLSEAVGACAVRGLLAGRVPPQGPWELQGILLLSQNELYRQILLLMHLLPQ
DLLLLKPCQSSYCYCQEVLDRLIQCGLLVAEETPGSRPACDTGRQRLSRKLLWKPSGDFT
DSDSDDFGEADGRYFRLSQQSHCPDFFLFLCRLLSPLLKAFAQAAAFLRQGQLPDTELGY
TEQLFQFLQATAQEEGIFECADPKLAISAVWTFRDLGVLQQTPSPAGPRLHLSPTFASLD
NQEKLEQFIRQFICS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6NUI2	1.000	1.000	0.000	795	1.000	1.000	Q6NUI2.pdb.gz	GPAT2_HUMAN Glycerol-3-phosphate acyltransferase 2, mitochondrial OS=Homo sapiens OX=9606 GN=GPAT2 PE=2 SV=2
2	AFDB:D3ZI76	0.939	0.932	5.972E-103	801	0.834	0.828	D3ZI76.pdb.gz	GPAT2_RAT Glycerol-3-phosphate acyltransferase 2, mitochondrial OS=Rattus norvegicus OX=10116 GN=Gpat2 PE=1 SV=1
3	AFDB:P97564	0.815	0.784	2.525E-49	828	0.317	0.304	P97564.pdb.gz	GPAT1_RAT Glycerol-3-phosphate acyltransferase 1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Gpam PE=1 SV=3
4	AFDB:Q9Y137	0.739	0.693	4.671E-30	850	0.182	0.171	Q9Y137.pdb.gz	Q9Y137_DROME BcDNA.GH07066 OS=Drosophila melanogaster OX=7227 GN=mino PE=1 SV=1
5	AFDB:Q22949	0.691	0.760	5.007E-28	718	0.186	0.206	Q22949.pdb.gz	PLSB_CAEEL Probable glycerol-3-phosphate acyltransferase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=acl-6 PE=3 SV=1
6	AFDB:Q54I12	0.668	0.426	4.867E-25	1279	0.174	0.108	Q54I12.pdb.gz	Q54I12_DICDI Phospholipid/glycerol acyltransferase domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0289081 PE=3 SV=1
7	AFDB:I7LW01	0.643	0.459	4.732E-22	1140	0.142	0.099	I7LW01.pdb.gz	I7LW01_TETTS Male sterility protein OS=Tetrahymena thermophila (strain SB210) OX=312017 GN=TTHERM_00221020 PE=3 SV=1
8	AFDB:P98192	0.640	0.742	4.732E-22	678	0.174	0.204	P98192.pdb.gz	GNPAT_MOUSE Dihydroxyacetone phosphate acyltransferase OS=Mus musculus OX=10090 GN=Gnpat PE=1 SV=1
9	AFDB:O15228	0.638	0.739	4.644E-20	680	0.142	0.166	O15228.pdb.gz	GNPAT_HUMAN Dihydroxyacetone phosphate acyltransferase OS=Homo sapiens OX=9606 GN=GNPAT PE=1 SV=1
10	AFDB:Q583Z3	0.605	0.400	1.399E-19	1242	0.158	0.101	Q583Z3.pdb.gz	Q583Z3_TRYB2 Dihydroxyacetone phosphate acyltransferase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.2H8.550 PE=3 SV=1
11	PDB:5f2tB	0.137	0.353	8.309E-4	262	0.062	0.187	5f2tB.pdb.gz	Structural basis for selective recognition of acyl chains by the membrane-associated acyltransferase PatA.
12	PDB:5gadi	0.103	0.159	7.537E-3	450	0.064	0.113	5gadi.pdb.gz	Structures of the E. coli translating ribosome with SRP and its receptor and with the translocon.
13	PDB:7jgsC	0.118	0.144	3.376E-2	614	0.118	0.153	7jgsC.pdb.gz	Structural mechanism for replication origin binding and remodeling by a metazoan origin recognition complex and its co-loader Cdc6.
14	PDB:7cteC	0.100	0.123	3.853E-2	592	0.113	0.152	7cteC.pdb.gz	Structural insight into the assembly and conformational activation of human origin recognition complex.
15	PDB:5afqB	0.077	0.130	6.541E-2	444	0.053	0.095	5afqB.pdb.gz	Structural Analysis of Human Rpc32Beta - Rpc62 Complex.
16	PDB:7a6hO	0.074	0.107	1.110E-1	512	0.039	0.061	7a6hO.pdb.gz	Cryo-EM structures of human RNA polymerase III in its unbound and transcribing states.
17	PDB:7d58O	0.081	0.121	1.267E-1	490	0.057	0.092	7d58O.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.
18	PDB:4xgcC	0.111	0.141	1.384E-1	567	0.109	0.153	4xgcC.pdb.gz	Crystal structure of the eukaryotic origin recognition complex.
19	PDB:2wj8N	0.078	0.118	1.804E-1	378	0.063	0.132	2wj8N.pdb.gz	Crystal Structure of a Nucleocapsid-Like Nucleoprotein-RNA Complex of Respiratory Syncytial Virus
20	PDB:4m9sB	0.158	0.208	2.456E-1	511	0.092	0.143	4m9sB.pdb.gz	Mechanistic insights into CED-4-mediated activation of CED-3.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3ZI76	0.0	1297	801	0.835	0.829	GPAT2_RAT Glycerol-3-phosphate acyltransferase 2, mitochondrial OS=Rattus norvegicus OX=10116 GN=Gpat2 PE=1 SV=1
2	Q14DK4	0.0	1298	801	0.831	0.825	GPAT2_MOUSE Glycerol-3-phosphate acyltransferase 2, mitochondrial OS=Mus musculus OX=10090 GN=Gpat2 PE=1 SV=3
3	Q6NUI2	0.0	1587	795	1.000	1.000	GPAT2_HUMAN Glycerol-3-phosphate acyltransferase 2, mitochondrial OS=Homo sapiens OX=9606 GN=GPAT2 PE=2 SV=2
4	Q61586	6.76e-114	367	827	0.319	0.307	GPAT1_MOUSE Glycerol-3-phosphate acyltransferase 1, mitochondrial OS=Mus musculus OX=10090 GN=Gpam PE=1 SV=2
5	Q9HCL2	9.00e-114	367	828	0.328	0.315	GPAT1_HUMAN Glycerol-3-phosphate acyltransferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=GPAM PE=1 SV=3
6	P97564	4.69e-112	362	828	0.317	0.304	GPAT1_RAT Glycerol-3-phosphate acyltransferase 1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Gpam PE=1 SV=3
7	Q22949	1.76e-21	102	718	0.121	0.134	PLSB_CAEEL Probable glycerol-3-phosphate acyltransferase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=acl-6 PE=3 SV=1
8	Q9Y137	2.81e-18	92.4	850	0.176	0.165	Q9Y137_DROME BcDNA.GH07066 OS=Drosophila melanogaster OX=7227 GN=mino PE=1 SV=1
9	G8JY39	2.34e-14	79.0	558	0.092	0.131	G8JY39_CAEEL Phospholipid/glycerol acyltransferase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=acl-6 PE=1 SV=1
10	G1SPE9	2.94e-08	59.7	679	0.092	0.108	G1SPE9_RABIT Dihydroxyacetone phosphate acyltransferase OS=Oryctolagus cuniculus OX=9986 GN=GNPAT PE=3 SV=2
11	Q54I12	1.01e-07	58.2	1279	0.055	0.034	Q54I12_DICDI Phospholipid/glycerol acyltransferase domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0289081 PE=3 SV=1
12	I7LW01	1.61e-07	57.8	1140	0.073	0.051	I7LW01_TETTS Male sterility protein OS=Tetrahymena thermophila (strain SB210) OX=312017 GN=TTHERM_00221020 PE=3 SV=1
13	Q9ES71	2.02e-07	57.0	678	0.092	0.108	GNPAT_RAT Dihydroxyacetone phosphate acyltransferase OS=Rattus norvegicus OX=10116 GN=Gnpat PE=1 SV=1
14	P98192	2.55e-07	56.6	678	0.092	0.108	GNPAT_MOUSE Dihydroxyacetone phosphate acyltransferase OS=Mus musculus OX=10090 GN=Gnpat PE=1 SV=1
15	O15228	8.91e-07	55.1	680	0.087	0.101	GNPAT_HUMAN Dihydroxyacetone phosphate acyltransferase OS=Homo sapiens OX=9606 GN=GNPAT PE=1 SV=1
16	Q583Z3	6.36e-05	49.3	1242	0.130	0.083	Q583Z3_TRYB2 Dihydroxyacetone phosphate acyltransferase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.2H8.550 PE=3 SV=1
17	Q4Q396	0.42	36.6	1436	0.078	0.043	Q4Q396_LEIMA Dihydroxyacetonephosphate acyltransferase OS=Leishmania major OX=5664 GN=DAT PE=3 SV=1
18	P0A7A7	0.51	36.2	807	0.050	0.050	PLSB_ECOLI Glycerol-3-phosphate acyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=plsB PE=1 SV=2
19	Q8IFP2	0.71	34.7	170	0.039	0.182	Q8IFP2_PLAF7 40S ribosomal protein S19 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0422400 PE=1 SV=1
20	P41810	4.2	33.5	973	0.034	0.028	COPB_YEAST Coatomer subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC26 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01553 Acyltransferase	1.7	19.7	Acyltransferase
2	PF19277 GPAT_C	4.4e+02	11.1	Glycerol-3-phosphate acyltransferase C-terminal region
3	PF04031 Las1	2.2e+02	13.3	Las1-like
4	PF02114 Phosducin	1.1e+02	13.1	Phosducin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000389395

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360761	0.970	1-acyl-sn-glycerol-3-phosphate acyltransferase beta
2	9606.ENSP00000378877	0.970	1-acyl-sn-glycerol-3-phosphate acyltransferase alpha
3	9606.ENSP00000285518	0.959	1-acyl-sn-glycerol-3-phosphate acyltransferase epsilon
4	9606.ENSP00000380184	0.959	Glycerol-3-phosphate acyltransferase 4
5	9606.ENSP00000482571	0.959	Glycerol-3-phosphate acyltransferase 3
6	9606.ENSP00000314036	0.955	1-acyl-sn-glycerol-3-phosphate acyltransferase delta
7	9606.ENSP00000302177	0.950	Lysophospholipid acyltransferase 2
8	9606.ENSP00000381140	0.950	1-acyl-sn-glycerol-3-phosphate acyltransferase gamma
9	9606.ENSP00000310551	0.937	Lysocardiolipin acyltransferase 1
10	9606.ENSP00000317300	0.937	Lysophospholipid acyltransferase LPCAT4
11	9606.ENSP00000390849	0.934	1-acylglycerol-3-phosphate O-acyltransferase ABHD5
12	9606.ENSP00000324944	0.932	Lysophospholipid acyltransferase 1
13	9606.ENSP00000261407	0.926	Lysophospholipid acyltransferase 5
14	9606.ENSP00000282541	0.925	Glycerol-3-phosphate dehydrogenase 1-like protein
15	9606.ENSP00000301149	0.925	Glycerol-3-phosphate dehydrogenase 1
16	9606.ENSP00000401720	0.919	Glycerol kinase
17	9606.ENSP00000308610	0.918	Glycerol-3-phosphate dehydrogenase, mitochondrial
18	9606.ENSP00000351706	0.911	Glycerol kinase 2
19	9606.ENSP00000245615	0.906	Lysophospholipid acyltransferase 7
20	9606.ENSP00000347581	0.902	Acylglycerol kinase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004366	1.000	glycerol-3-phosphate O-acyltransferase activity
GO:0005515	0.828	protein binding
GO:0071617	0.650	lysophospholipid acyltransferase activity
GO:0042171	0.622	lysophosphatidic acid acyltransferase activity
GO:0016411	0.516	acylglycerol O-acyltransferase activity
GO:0003841	0.444	1-acylglycerol-3-phosphate O-acyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.998	primary metabolic process
GO:0044237	0.998	cellular metabolic process
GO:1901576	0.995	organic substance biosynthetic process
GO:0044249	0.992	cellular biosynthetic process
GO:0044255	0.991	cellular lipid metabolic process
GO:0008610	0.988	lipid biosynthetic process
GO:0019637	0.986	organophosphate metabolic process
GO:0006796	0.985	phosphate-containing compound metabolic process
GO:0006654	0.982	phosphatidic acid biosynthetic process
GO:0006807	0.469	nitrogen compound metabolic process
GO:0050789	0.367	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0031090	0.999	organelle membrane
GO:0031967	0.987	organelle envelope
GO:0098588	0.985	bounding membrane of organelle
GO:0031966	0.958	mitochondrial membrane
GO:0019867	0.928	outer membrane
GO:0005741	0.916	mitochondrial outer membrane
GO:0012505	0.424	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:15325	1.000	an acyl-CoA + sn-glycerol 3-phosphate = a 1-acyl-sn-glycero-3-phosphate + CoA
EC:2.3.1.15	1.000	glycerol-3-phosphate 1-O-acyltransferase.
RHEA:19709	0.444	a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA
EC:2.3.1.51	0.444	1-acylglycerol-3-phosphate O-acyltransferase.

[back to server]