StarFunc result for job id Q6NUJ5

User Input

>input (590 residues)
MEPRAGCRLPVRVEQVVNGALVVTVSCGERSFAGILLDCTKKSGLFGLPPLAPLPQVDES
PVNDSHGRAPEEGDAEVMQLGSSSPPPARGVQPPETTRPEPPPPLVPPLPAGSLPPYPPY
FEGAPFPHPLWLRDTYKLWVPQPPPRTIKRTRRRLSRNRDPGRLILSTIRLRPRQVLCEK
CKSTLSPPEASPGPPAAPRARRRLGSGPDRELRKPEEPENGEPTAAATARRSKRERREED
RAPAEQVPRSPVIKISYSTPQGKGEVVKIPSRVHGSLEPFRPQQAPQDDGSQDPEVLDRE
SRDRPSCAPSASIPKLKLTRPVPAGADLPPPKIRLKPHRLGDSEHEPVYRAELVGELNGY
LRDSSPAPCADGPAGGLADLSSGSSGEDDDFKSCPQGPQGREGLAFLVSCPEGRADCASE
SACSSDSLDEARSSGSEGTPADTGDLSPGHGASAPSVSREARQTVPPLTVRLHTQSVSEC
ITEDGRTVAVGDIVWGKIHGFPWWPARVLDISLGQKEDGEPSWREAKVSWFGSPTTSFLS
ISKLSPFSEFFKLRFNRKKKGMYRKAITEAANAARHVAPEIRELLTQFET

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6NUJ5	0.999	0.999	1.838E-87	590	1.000	1.000	Q6NUJ5.pdb.gz	PWP2B_HUMAN PWWP domain-containing protein 2B OS=Homo sapiens OX=9606 GN=PWWP2B PE=1 SV=3
2	AFDB:E9Q9M8	0.447	0.440	1.475E-68	600	0.793	0.780	E9Q9M8.pdb.gz	PWP2B_MOUSE PWWP domain-containing protein 2B OS=Mus musculus OX=10090 GN=Pwwp2b PE=1 SV=1
3	AFDB:A0A1L8GR68	0.195	0.149	1.228E-27	784	0.314	0.236	A0A1L8GR68.pdb.gz	PWP2A_XENLA PWWP domain-containing protein 2A OS=Xenopus laevis OX=8355 GN=pwwp2a PE=3 SV=2
4	AFDB:F7AQ22	0.189	0.144	9.430E-27	784	0.317	0.239	F7AQ22.pdb.gz	PWP2A_XENTR PWWP domain-containing protein 2A OS=Xenopus tropicalis OX=8364 GN=pwwp2a PE=2 SV=2
5	AFDB:Q96N64	0.204	0.163	1.729E-26	755	0.325	0.254	Q96N64.pdb.gz	PWP2A_HUMAN PWWP domain-containing protein 2A OS=Homo sapiens OX=9606 GN=PWWP2A PE=1 SV=2
6	AFDB:Q69Z61	0.189	0.154	2.839E-26	730	0.325	0.263	Q69Z61.pdb.gz	PWP2A_MOUSE PWWP domain-containing protein 2A OS=Mus musculus OX=10090 GN=Pwwp2a PE=2 SV=2
7	PDB:6s01K	0.116	0.696	2.372E-3	86	0.037	0.256	6s01K.pdb.gz	Structure of H3K36-methylated nucleosome-PWWP complex reveals multivalent cross-gyre binding.
8	PDB:5z8lA	0.102	0.274	2.679E-2	204	0.031	0.088	5z8lA.pdb.gz	EBS is a bivalent histone reader that regulates floral phase transition in Arabidopsis.
9	PDB:7e29A	0.106	0.125	4.912E-2	496	0.027	0.032	7e29A.pdb.gz	H3K36 methylation and DNA-binding both promote Ioc4 recruitment and Isw1b remodeler function.
10	AFDB:Q9BQF6	0.075	0.048	6.882E-2	1050	0.158	0.089	Q9BQF6.pdb.gz	SENP7_HUMAN Sentrin-specific protease 7 OS=Homo sapiens OX=9606 GN=SENP7 PE=1 SV=4
11	AFDB:A0A024R9K2	0.098	0.077	7.272E-2	780	0.193	0.146	A0A024R9K2.pdb.gz
12	PDB:4zn3A	0.076	0.277	2.298E-1	147	0.017	0.068	4zn3A.pdb.gz	Structural and biochemical insights into the DNA-binding mode of MjSpt4p:Spt5 complex at the exit tunnel of RNAPII
13	AFDB:P53814	0.060	0.043	2.582E-1	917	0.186	0.120	P53814.pdb.gz	SMTN_HUMAN Smoothelin OS=Homo sapiens OX=9606 GN=SMTN PE=1 SV=7
14	PDB:6tedR	0.100	0.207	2.711E-1	244	0.025	0.061	6tedR.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
15	PDB:6tedZ	0.052	0.059	3.570E-1	510	0.014	0.016	6tedZ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
16	PDB:7okyZ	0.054	0.083	3.570E-1	374	0.017	0.027	7okyZ.pdb.gz	Allosteric transcription stimulation by RNA polymerase II super elongation complex.
17	AFDB:Q54Q16	0.052	0.027	4.013E-1	1917	0.146	0.045	Q54Q16.pdb.gz	Q54Q16_DICDI Chromo domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0284171 PE=4 SV=1
18	PDB:3mp8A	0.075	0.085	5.251E-1	513	0.019	0.021	3mp8A.pdb.gz	Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation
19	PDB:1khiA	0.073	0.269	5.863E-1	147	0.015	0.061	1khiA.pdb.gz
20	PDB:3k1lA	0.072	0.102	6.195E-1	376	0.017	0.027	3k1lA.pdb.gz	The structure of the catalytic subunit FANCL of the Fanconi anemia core complex

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9Q9M8	0.0	847	600	0.797	0.783	PWP2B_MOUSE PWWP domain-containing protein 2B OS=Mus musculus OX=10090 GN=Pwwp2b PE=1 SV=1
2	Q6NUJ5	0.0	1169	590	1.000	1.000	PWP2B_HUMAN PWWP domain-containing protein 2B OS=Homo sapiens OX=9606 GN=PWWP2B PE=1 SV=3
3	Q69Z61	2.33e-86	285	730	0.359	0.290	PWP2A_MOUSE PWWP domain-containing protein 2A OS=Mus musculus OX=10090 GN=Pwwp2a PE=2 SV=2
4	Q96N64	3.36e-86	285	755	0.354	0.277	PWP2A_HUMAN PWWP domain-containing protein 2A OS=Homo sapiens OX=9606 GN=PWWP2A PE=1 SV=2
5	F7AQ22	2.55e-81	273	784	0.334	0.251	PWP2A_XENTR PWWP domain-containing protein 2A OS=Xenopus tropicalis OX=8364 GN=pwwp2a PE=2 SV=2
6	A0A1L8GR68	1.74e-77	263	784	0.331	0.249	PWP2A_XENLA PWWP domain-containing protein 2A OS=Xenopus laevis OX=8355 GN=pwwp2a PE=3 SV=2
7	Q4W5Z4	2.56e-11	68.9	877	0.068	0.046	DNM3A_CHICK DNA (cytosine-5)-methyltransferase 3A OS=Gallus gallus OX=9031 GN=DNMT3A PE=2 SV=1
8	Q9Y6K1	3.29e-11	68.9	912	0.063	0.041	DNM3A_HUMAN DNA (cytosine-5)-methyltransferase 3A OS=Homo sapiens OX=9606 GN=DNMT3A PE=1 SV=4
9	O88508	3.43e-11	68.6	908	0.063	0.041	DNM3A_MOUSE DNA (cytosine-5)-methyltransferase 3A OS=Mus musculus OX=10090 GN=Dnmt3a PE=1 SV=2
10	Q1LZ53	3.43e-11	68.6	908	0.063	0.041	DNM3A_RAT DNA (cytosine-5)-methyltransferase 3A OS=Rattus norvegicus OX=10116 GN=Dnmt3a PE=1 SV=1
11	Q9UBC3	3.22e-10	65.5	853	0.068	0.047	DNM3B_HUMAN DNA (cytosine-5)-methyltransferase 3B OS=Homo sapiens OX=9606 GN=DNMT3B PE=1 SV=1
12	O88509	9.16e-10	63.9	859	0.066	0.045	DNM3B_MOUSE DNA (cytosine-5)-methyltransferase 3B OS=Mus musculus OX=10090 GN=Dnmt3b PE=1 SV=2
13	A0A8J8XG14	8.67e-09	60.8	860	0.063	0.043	A0A8J8XG14_RAT DNA (cytosine-5-)-methyltransferase OS=Rattus norvegicus OX=10116 GN=Dnmt3b PE=3 SV=1
14	A0A8I6AVL3	8.73e-09	60.8	839	0.063	0.044	A0A8I6AVL3_RAT DNA (cytosine-5-)-methyltransferase OS=Rattus norvegicus OX=10116 GN=Dnmt3b PE=3 SV=1
15	Q1LZ51	8.89e-09	60.8	859	0.063	0.043	Q1LZ51_RAT DNA (cytosine-5-)-methyltransferase OS=Rattus norvegicus OX=10116 GN=Dnmt3b PE=2 SV=1
16	A0A0G2JYR2	9.08e-09	60.8	796	0.063	0.046	A0A0G2JYR2_RAT DNA (cytosine-5-)-methyltransferase OS=Rattus norvegicus OX=10116 GN=Dnmt3b PE=3 SV=2
17	Q588C6	6.65e-07	54.7	816	0.054	0.039	Q588C6_DANRE DNA (cytosine-5-)-methyltransferase OS=Danio rerio OX=7955 GN=cb633 PE=1 SV=1
18	Q9FNE4	2.41e-06	53.1	1008	0.046	0.027	PDP3_ARATH PWWP domain-containing protein 3 OS=Arabidopsis thaliana OX=3702 GN=PDP3 PE=1 SV=1
19	Q9JMG7	1.37e-04	45.4	202	0.046	0.134	HDGR3_MOUSE Hepatoma-derived growth factor-related protein 3 OS=Mus musculus OX=10090 GN=Hdgfl3 PE=1 SV=2
20	Q9Y3E1	1.47e-04	45.4	203	0.046	0.133	HDGR3_HUMAN Hepatoma-derived growth factor-related protein 3 OS=Homo sapiens OX=9606 GN=HDGFL3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00855 PWWP	4.1e-10	51.4	PWWP domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000306324

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000388431	0.820	Transmembrane protein 251
2	9606.ENSP00000396976	0.757	Bromo adjacent homology domain-containing 1 protein
3	9606.ENSP00000378784	0.737	PHD finger protein 20 like 1
4	9606.ENSP00000371133	0.734	High mobility group protein 20A
5	9606.ENSP00000385795	0.728	PHD finger protein 14
6	9606.ENSP00000258281	0.695	TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L
7	9606.ENSP00000442129	0.681	Hepatoma-derived growth factor-like protein 1
8	9606.ENSP00000324404	0.657	Trichoplein keratin filament-binding protein
9	9606.ENSP00000353463	0.646	Transcriptional repressor p66-alpha
10	9606.ENSP00000238497	0.627	Vacuolar protein sorting-associated protein 4B
11	9606.ENSP00000304327	0.623	Coordinator of PRMT5 and differentiation stimulator
12	9606.ENSP00000393795	0.608	Zinc finger protein 512B
13	9606.ENSP00000342019	0.541	Zinc finger protein 189
14	9606.ENSP00000284503	0.527	Endonuclease 8-like 2
15	9606.ENSP00000341422	0.507	Transmembrane prolyl 4-hydroxylase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0044877	0.995	protein-containing complex binding
GO:0120325	0.828	NuRD complex binding
GO:0097159	0.366	organic cyclic compound binding
GO:1901363	0.363	heterocyclic compound binding
GO:0003676	0.341	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0060255	0.995	regulation of macromolecule metabolic process
GO:0006355	0.985	regulation of DNA-templated transcription
GO:0048518	0.983	positive regulation of biological process
GO:0009893	0.971	positive regulation of metabolic process
GO:0048522	0.965	positive regulation of cellular process
GO:0051173	0.950	positive regulation of nitrogen compound metabolic process
GO:0048519	0.909	negative regulation of biological process
GO:0016043	0.907	cellular component organization
GO:0010604	0.890	positive regulation of macromolecule metabolic process
GO:0031325	0.879	positive regulation of cellular metabolic process
GO:0006338	0.858	chromatin remodeling
GO:0006357	0.851	regulation of transcription by RNA polymerase II
GO:0045935	0.830	positive regulation of nucleobase-containing compound metabolic process
GO:0010605	0.819	negative regulation of macromolecule metabolic process
GO:0051172	0.815	negative regulation of nitrogen compound metabolic process
GO:0032784	0.800	regulation of DNA-templated transcription elongation
GO:0034243	0.764	regulation of transcription elongation by RNA polymerase II
GO:0009891	0.759	positive regulation of biosynthetic process
GO:0010557	0.739	positive regulation of macromolecule biosynthetic process
GO:0031328	0.738	positive regulation of cellular biosynthetic process
GO:0032968	0.720	positive regulation of transcription elongation by RNA polymerase II
GO:0008152	0.715	metabolic process
GO:0071704	0.656	organic substance metabolic process
GO:0051246	0.551	regulation of protein metabolic process
GO:0044238	0.520	primary metabolic process
GO:0006807	0.491	nitrogen compound metabolic process
GO:0044237	0.491	cellular metabolic process
GO:1901983	0.459	regulation of protein acetylation
GO:0043170	0.450	macromolecule metabolic process
GO:0048523	0.413	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.591	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]