StarFunc result for job id Q6NUK1

User Input

>input (477 residues)
MLRWLRDFVLPTAACQDAEQPTRYETLFQALDRNGDGVVDIGELQEGLRNLGIPLGQDAE
EKIFTTGDVNKDGKLDFEEFMKYLKDHEKKMKLAFKSLDKNNDGKIEASEIVQSLQTLGL
TISEQQAELILQSIDVDGTMTVDWNEWRDYFLFNPVTDIEEIIRFWKHSTGIDIGDSLTI
PDEFTEDEKKSGQWWRQLLAGGIAGAVSRTSTAPLDRLKIMMQVHGSKSDKMNIFGGFRQ
MVKEGGIRSLWRGNGTNVIKIAPETAVKFWAYEQYKKLLTEEGQKIGTFERFISGSMAGA
TAQTFIYPMEVMKTRLAVGKTGQYSGIYDCAKKILKHEGLGAFYKGYVPNLLGIIPYAGI
DLAVYELLKSYWLDNFAKDSVNPGVMVLLGCGALSSTCGQLASYPLALVRTRMQAQAMLE
GSPQLNMVGLFRRIISKEGIPGLYRGITPNFMKVLPAVGISYVVYENMKQTLGVTQK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6NUK1	1.000	1.000	3.756E-66	477	1.000	1.000	Q6NUK1.pdb.gz	SCMC1_HUMAN Mitochondrial adenyl nucleotide antiporter SLC25A24 OS=Homo sapiens OX=9606 GN=SLC25A24 PE=1 SV=2
2	AFDB:B1AUS6	0.904	0.911	4.440E-44	473	0.589	0.594	B1AUS6.pdb.gz	B1AUS6_MOUSE Solute carrier family 25, member 54 OS=Mus musculus OX=10090 GN=Slc25a54 PE=1 SV=1
3	AFDB:Q9BV35	0.794	0.808	2.396E-43	468	0.591	0.603	Q9BV35.pdb.gz	SCMC3_HUMAN Mitochondrial adenyl nucleotide antiporter SLC25A23 OS=Homo sapiens OX=9606 GN=SLC25A23 PE=1 SV=2
4	AFDB:A2CEQ0	0.716	0.728	5.501E-41	469	0.600	0.610	A2CEQ0.pdb.gz	SCM2B_DANRE Calcium-binding mitochondrial carrier protein SCaMC-2-B OS=Danio rerio OX=7955 GN=slc25a25b PE=3 SV=2
5	AFDB:A2ASZ8	0.706	0.718	2.119E-40	469	0.587	0.597	A2ASZ8.pdb.gz	SCMC2_MOUSE Mitochondrial adenyl nucleotide antiporter SLC25A25 OS=Mus musculus OX=10090 GN=Slc25a25 PE=1 SV=1
6	AFDB:Q9FI43	0.584	0.574	1.689E-30	487	0.388	0.380	Q9FI43.pdb.gz	MAPC2_ARATH Calcium-dependent mitochondrial ATP-magnesium/phosphate carrier protein 2 OS=Arabidopsis thaliana OX=3702 GN=APC2 PE=1 SV=1
7	AFDB:Q9LY28	0.585	0.582	4.269E-30	479	0.377	0.376	Q9LY28.pdb.gz	MAPC3_ARATH Calcium-dependent mitochondrial ATP-magnesium/phosphate carrier protein 3 OS=Arabidopsis thaliana OX=3702 GN=APC3 PE=1 SV=1
8	AFDB:Q9FLS8	0.580	0.579	1.866E-29	478	0.377	0.377	Q9FLS8.pdb.gz	MAPC1_ARATH Calcium-dependent mitochondrial ATP-magnesium/phosphate carrier protein 1 OS=Arabidopsis thaliana OX=3702 GN=APC1 PE=1 SV=1
9	AFDB:Q8BVN7	0.569	0.854	1.546E-22	312	0.346	0.529	Q8BVN7.pdb.gz	S2541_MOUSE Calcium-independent mitochondrial carrier protein SCaMC-3L OS=Mus musculus OX=10090 GN=Slc25a41 PE=1 SV=1
10	AFDB:Q9M058	0.562	0.798	1.836E-19	332	0.241	0.346	Q9M058.pdb.gz	Q9M058_ARATH Ca-dependent solute carrier-like protein OS=Arabidopsis thaliana OX=3702 GN=F1I16_50 PE=1 SV=1
11	PDB:4c9qB	0.498	0.790	5.981E-13	290	0.161	0.266	4c9qB.pdb.gz	Structures of Yeast Mitochondrial Adp/ATP Carriers Support a Domain-Based Alternating-Access Transport Mechanism
12	PDB:2c3eA	0.481	0.759	2.967E-12	293	0.176	0.287	2c3eA.pdb.gz	Structural Basis for Lipid-Mediated Interactions between Mitochondrial Adp/ATP Carrier Monomers.
13	PDB:6gciA	0.371	0.549	5.290E-10	292	0.176	0.288	6gciA.pdb.gz	The Molecular Mechanism of Transport by the Mitochondrial ADP/ATP Carrier.
14	PDB:5a2hA	0.141	0.418	1.104E-5	147	0.073	0.238	5a2hA.pdb.gz	Crystal Structure of Arabidopsis Thaliana Calmodulin7 and Insight Into its Mode of DNA Binding.
15	PDB:2f2pA	0.149	0.374	1.546E-5	169	0.082	0.231	2f2pA.pdb.gz	Structure of calmodulin bound to a calcineurin Peptide: a new way of making an old binding mode.
16	PDB:1osaA	0.146	0.437	1.682E-5	148	0.073	0.236	1osaA.pdb.gz	Structure of the recombinant Paramecium tetraurelia calmodulin at 1.68 A resolution.
17	PDB:1ggzA	0.146	0.444	3.301E-5	144	0.075	0.250	1ggzA.pdb.gz	Crystal structure of human calmodulin-like protein: insights into its functional role.
18	PDB:5d43A	0.152	0.432	4.076E-5	150	0.071	0.227	5d43A.pdb.gz	Crystal Structure of Wild-Type Centrin 1 from Mus musculus Occupied by Ca2.
19	PDB:4e53A	0.147	0.365	8.343E-5	168	0.086	0.244	4e53A.pdb.gz
20	PDB:2ggmA	0.139	0.418	1.272E-4	149	0.071	0.228	2ggmA.pdb.gz	The structure of the human centrin 2-xeroderma pigmentosum group C protein complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2ASZ8	0.0	602	469	0.574	0.584	SCMC2_MOUSE Mitochondrial adenyl nucleotide antiporter SLC25A25 OS=Mus musculus OX=10090 GN=Slc25a25 PE=1 SV=1
2	A2CEQ0	0.0	613	469	0.589	0.599	SCM2B_DANRE Calcium-binding mitochondrial carrier protein SCaMC-2-B OS=Danio rerio OX=7955 GN=slc25a25b PE=3 SV=2
3	B1AUS6	0.0	610	473	0.595	0.600	B1AUS6_MOUSE Solute carrier family 25, member 54 OS=Mus musculus OX=10090 GN=Slc25a54 PE=1 SV=1
4	Q6GQS1	0.0	618	467	0.591	0.604	SCMC3_MOUSE Mitochondrial adenyl nucleotide antiporter SLC25A23 OS=Mus musculus OX=10090 GN=Slc25a23 PE=1 SV=1
5	Q6NUK1	0.0	984	477	1.000	1.000	SCMC1_HUMAN Mitochondrial adenyl nucleotide antiporter SLC25A24 OS=Homo sapiens OX=9606 GN=SLC25A24 PE=1 SV=2
6	Q8BMD8	0.0	924	475	0.933	0.937	SCMC1_MOUSE Mitochondrial adenyl nucleotide antiporter SLC25A24 OS=Mus musculus OX=10090 GN=Slc25a24 PE=1 SV=1
7	Q9BV35	0.0	618	468	0.600	0.611	SCMC3_HUMAN Mitochondrial adenyl nucleotide antiporter SLC25A23 OS=Homo sapiens OX=9606 GN=SLC25A23 PE=1 SV=2
8	Q9D5G5	0.0	609	473	0.595	0.600	Q9D5G5_MOUSE EF-hand domain-containing protein OS=Mus musculus OX=10090 GN=Slc25a54 PE=2 SV=1
9	Q9FI43	4.53e-114	346	487	0.405	0.396	MAPC2_ARATH Calcium-dependent mitochondrial ATP-magnesium/phosphate carrier protein 2 OS=Arabidopsis thaliana OX=3702 GN=APC2 PE=1 SV=1
10	Q8BVN7	4.25e-113	338	312	0.356	0.545	S2541_MOUSE Calcium-independent mitochondrial carrier protein SCaMC-3L OS=Mus musculus OX=10090 GN=Slc25a41 PE=1 SV=1
11	Q9FLS8	3.41e-109	333	478	0.377	0.377	MAPC1_ARATH Calcium-dependent mitochondrial ATP-magnesium/phosphate carrier protein 1 OS=Arabidopsis thaliana OX=3702 GN=APC1 PE=1 SV=1
12	Q9LY28	1.10e-102	317	479	0.379	0.378	MAPC3_ARATH Calcium-dependent mitochondrial ATP-magnesium/phosphate carrier protein 3 OS=Arabidopsis thaliana OX=3702 GN=APC3 PE=1 SV=1
13	Q6I583	2.36e-61	206	355	0.237	0.318	Q6I583_ORYSJ Os05g0585900 protein OS=Oryza sativa subsp. japonica OX=39947 GN=Os05g0585900 PE=1 SV=1
14	Q9M058	5.32e-61	204	332	0.254	0.364	Q9M058_ARATH Ca-dependent solute carrier-like protein OS=Arabidopsis thaliana OX=3702 GN=F1I16_50 PE=1 SV=1
15	F4JHS4	3.88e-57	195	366	0.233	0.303	F4JHS4_ARATH Adenine nucleotide transporter 1 OS=Arabidopsis thaliana OX=3702 GN=ADNT1 PE=1 SV=1
16	O94502	4.40e-56	194	426	0.243	0.272	YBT5_SCHPO Uncharacterized mitochondrial carrier C12D12.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC12D12.05c PE=3 SV=2
17	P16260	6.48e-56	191	332	0.224	0.322	GDC_HUMAN Solute carrier family 25 member 16 OS=Homo sapiens OX=9606 GN=SLC25A16 PE=1 SV=3
18	Q8C0K5	1.38e-54	187	332	0.231	0.331	GDC_MOUSE Solute carrier family 25 member 16 OS=Mus musculus OX=10090 GN=Slc25a16 PE=1 SV=1
19	B4F8I5	1.43e-54	187	335	0.220	0.313	COAC2_MAIZE Mitochondrial carrier protein CoAc2 OS=Zea mays OX=4577 GN=COAC2 PE=2 SV=1
20	Q0P483	8.26e-53	182	321	0.216	0.321	S2542_DANRE Mitochondrial coenzyme A transporter SLC25A42 OS=Danio rerio OX=7955 GN=slc25a42 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05042 Caleosin	55	15.1	Caleosin related protein
2	PF00404 Dockerin_1	1.4	20.5	Dockerin type I domain
3	PF00036 EF-hand_1	3.2e-17	71.8	EF hand
4	PF14788 EF-hand_10	0.33	22.2	EF hand
5	PF12763 EF-hand_4	0.03	25.6	Cytoskeletal-regulatory complex EF hand
6	PF13202 EF-hand_5	3.7e-13	59.5	EF hand
7	PF13405 EF-hand_6	1.2e-15	66.9	EF-hand domain
8	PF13499 EF-hand_7	5.3e-18	76.6	EF-hand domain pair
9	PF13833 EF-hand_8	3.5e-09	47.6	EF-hand domain pair
10	PF14658 EF-hand_9	5.3e+02	12.4	EF-hand domain
11	PF00153 Mito_carr	8.2e-72	248.5	Mitochondrial carrier protein
12	PF01665 Rota_NSP3	3.9e+02	11.6	Rotavirus non-structural protein NSP3
13	PF13791 Sigma_reg_C	1.2e+02	14.4	Sigma factor regulator C-terminal
14	PF10591 SPARC_Ca_bdg	0.0018	30.0	Secreted protein acidic and rich in cysteine Ca binding region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000457733

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000281456	0.882	ADP/ATP translocase 1
2	9606.ENSP00000385510	0.815	G-protein-signaling modulator 2
3	9606.ENSP00000360671	0.768	ADP/ATP translocase 2
4	9606.ENSP00000359073	0.726	Guanine nucleotide exchange factor VAV3
5	9606.ENSP00000356030	0.650	Complement decay-accelerating factor
6	9606.ENSP00000239461	0.567	Paired mesoderm homeobox protein 1
7	9606.ENSP00000483333	0.532	SKI family transcriptional corepressor 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005509	1.000	calcium ion binding
GO:0005347	0.998	ATP transmembrane transporter activity
GO:0005515	0.817	protein binding
GO:0015217	0.674	ADP transmembrane transporter activity
GO:0015318	0.392	inorganic molecular entity transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0051234	0.912	establishment of localization
GO:0006810	0.899	transport
GO:0065007	0.821	biological regulation
GO:0071705	0.761	nitrogen compound transport
GO:0071702	0.733	organic substance transport
GO:0015748	0.705	organophosphate ester transport
GO:0051503	0.702	adenine nucleotide transport
GO:0050789	0.693	regulation of biological process
GO:0050794	0.675	regulation of cellular process
GO:0050896	0.555	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0016020	0.974	membrane
GO:0032991	0.387	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]