StarFunc result for job id Q6NUN0

User Input

>input (579 residues)
MRPWLRHLVLQALRNSRAFCGSHGKPAPLPVPQKIVATWEAISLGRQLVPEYFNFAHDVL
DVWSRLEEAGHRPPNPAFWWVNGTGAEIKWSFEELGKQSRKAANVLGGACGLQPGDRMML
VLPRLPEWWLVSVACMRTGTVMIPGVTQLTEKDLKYRLQASRAKSIITSDSLAPRVDAIS
AECPSLQTKLLVSDSSRPGWLNFRELLREASTEHNCMRTKSRDPLAIYFTSGTTGAPKMV
EHSQSSYGLGFVASGRRWVALTESDIFWNTTDTGWVKAAWTLFSAWPNGSCIFVHELPRV
DAKVILNTLSKFPITTLCCVPTIFRLLVQEDLTRYQFQSLRHCLTGGEALNPDVREKWKH
QTGVELYEGYGQSETVVICANPKGMKIKSGSMGKASPPYDVQIVDDEGNVLPPGEEGNVA
VRIRPTRPFCFFNCYLDNPEKTAASEQGDFYITGDRARMDKDGYFWFMGRNDDVINSSSY
RIGPVEVESALAEHPAVLESAVVSSPDPIRGEVVKAFIVLTPAYSSHDPEALTRELQEHV
KRVTAPYKYPRKVAFVSELPKTVSGKIQRSKLRSQEWGK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7TN78	0.771	0.769	3.075E-93	580	0.606	0.605	Q7TN78.pdb.gz	ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acsm4 PE=1 SV=1
2	AFDB:Q3UNX5	0.920	0.919	8.697E-90	580	0.570	0.569	Q3UNX5.pdb.gz	ACSM3_MOUSE Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Mus musculus OX=10090 GN=Acsm3 PE=1 SV=2
3	AFDB:Q08AH3	0.909	0.912	1.037E-86	577	0.530	0.532	Q08AH3.pdb.gz	ACS2A_HUMAN Acyl-coenzyme A synthetase ACSM2A, mitochondrial OS=Homo sapiens OX=9606 GN=ACSM2A PE=1 SV=2
4	AFDB:Q53FZ2	0.755	0.747	1.037E-86	586	0.580	0.573	Q53FZ2.pdb.gz	ACSM3_HUMAN Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Homo sapiens OX=9606 GN=ACSM3 PE=1 SV=2
5	PDB:3b7wA	0.907	0.978	1.005E-85	537	0.530	0.572	3b7wA.pdb.gz	Structural snapshots for the conformation-dependent catalysis by human medium-chain acyl-coenzyme A synthetase ACSM2A.
6	AFDB:Q8K0L3	0.912	0.918	2.462E-85	575	0.515	0.518	Q8K0L3.pdb.gz	ACSM2_MOUSE Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Mus musculus OX=10090 GN=Acsm2 PE=1 SV=1
7	AFDB:Q08AH1	0.913	0.916	3.283E-85	577	0.553	0.555	Q08AH1.pdb.gz	ACSM1_HUMAN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Homo sapiens OX=9606 GN=ACSM1 PE=1 SV=1
8	AFDB:Q9BEA2	0.734	0.737	8.748E-84	577	0.546	0.548	Q9BEA2.pdb.gz	ACSM1_BOVIN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Bos taurus OX=9913 GN=ACSM1 PE=1 SV=2
9	AFDB:Q91VA0	0.899	0.909	2.201E-82	573	0.509	0.515	Q91VA0.pdb.gz	ACSM1_MOUSE Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Mus musculus OX=10090 GN=Acsm1 PE=1 SV=1
10	AFDB:Q729U8	0.714	0.749	1.414E-63	551	0.396	0.416	Q729U8.pdb.gz	Q729U8_DESVH AMP-binding protein OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=DVU_2250 PE=1 SV=1
11	AFDB:A4YDT1	0.698	0.715	4.258E-55	564	0.352	0.362	A4YDT1.pdb.gz	HBCL1_METS5 4-hydroxybutyrate--CoA ligase 1 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2) OX=399549 GN=Msed_0406 PE=1 SV=1
12	PDB:2p20A	0.835	0.756	1.858E-46	641	0.259	0.234	2p20A.pdb.gz	Biochemical and Crystallographic Analysis of Substrate Binding and Conformational Changes in Acetyl-CoA Synthetase.
13	PDB:1ry2A	0.682	0.644	9.892E-44	615	0.249	0.234	1ry2A.pdb.gz	Crystal structure of yeast acetyl-coenzyme A synthetase in complex with AMP
14	PDB:5bsmA	0.648	0.704	2.491E-41	530	0.226	0.247	5bsmA.pdb.gz	Structural Basis for Specificity and Flexibility in a Plant 4-Coumarate:CoA Ligase.
15	PDB:1ultA	0.655	0.708	4.693E-41	533	0.244	0.265	1ultA.pdb.gz
16	PDB:6q2mA	0.664	0.704	4.693E-41	544	0.202	0.215	6q2mA.pdb.gz	Mutagenesis and Structural Studies Reveal the Basis for the Activity and Stability Properties That Distinguish thePhotinusLuciferasesscintillansandpyralis.
17	PDB:5ie2A	0.610	0.691	5.914E-40	506	0.225	0.257	5ie2A.pdb.gz	Crystal Structures of Arabidopsis thaliana Oxalyl-CoA Synthetase Essential for Oxalate Degradation
18	PDB:3r44A	0.631	0.723	1.668E-39	502	0.225	0.259	3r44A.pdb.gz	The Mycobacterium tuberculosis Very-Long-Chain Fatty Acyl-CoA Synthetase: Structural Basis for Housing Lipid Substrates Longer than the Enzyme.
19	PDB:3rg2C	0.785	0.743	2.643E-39	613	0.195	0.184	3rg2C.pdb.gz	Structural and Functional Investigation of the Intermolecular Interaction between NRPS Adenylation and Carrier Protein Domains.
20	PDB:7kydA	0.648	0.699	4.707E-38	534	0.199	0.215	7kydA.pdb.gz	FruitFire: a luciferase based on a fruit fly metabolic enzyme.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q08AH1	0.0	672	577	0.561	0.563	ACSM1_HUMAN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Homo sapiens OX=9606 GN=ACSM1 PE=1 SV=1
2	Q08AH3	0.0	659	577	0.527	0.529	ACS2A_HUMAN Acyl-coenzyme A synthetase ACSM2A, mitochondrial OS=Homo sapiens OX=9606 GN=ACSM2A PE=1 SV=2
3	Q3UNX5	0.0	741	580	0.568	0.567	ACSM3_MOUSE Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Mus musculus OX=10090 GN=Acsm3 PE=1 SV=2
4	Q53FZ2	0.0	746	586	0.572	0.565	ACSM3_HUMAN Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Homo sapiens OX=9606 GN=ACSM3 PE=1 SV=2
5	Q68CK6	0.0	659	577	0.520	0.522	ACS2B_HUMAN Acyl-coenzyme A synthetase ACSM2B, mitochondrial OS=Homo sapiens OX=9606 GN=ACSM2B PE=1 SV=2
6	Q7TN78	0.0	747	580	0.601	0.600	ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acsm4 PE=1 SV=1
7	Q80W40	0.0	751	580	0.604	0.603	ACSM4_MOUSE Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Mus musculus OX=10090 GN=Acsm4 PE=2 SV=1
8	Q8K0L3	0.0	644	575	0.513	0.517	ACSM2_MOUSE Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Mus musculus OX=10090 GN=Acsm2 PE=1 SV=1
9	Q91VA0	0.0	642	573	0.515	0.520	ACSM1_MOUSE Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Mus musculus OX=10090 GN=Acsm1 PE=1 SV=1
10	Q9BEA2	0.0	688	577	0.546	0.548	ACSM1_BOVIN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Bos taurus OX=9913 GN=ACSM1 PE=1 SV=2
11	Q729U8	4.59e-148	439	551	0.404	0.425	Q729U8_DESVH AMP-binding protein OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=DVU_2250 PE=1 SV=1
12	A4YDT1	9.05e-105	328	564	0.352	0.362	HBCL1_METS5 4-hydroxybutyrate--CoA ligase 1 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2) OX=399549 GN=Msed_0406 PE=1 SV=1
13	Q726Y7	1.11e-63	223	661	0.295	0.259	Q726Y7_DESVH Acetyl-coenzyme A synthetase OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=acsA PE=1 SV=1
14	P9WQD1	1.36e-58	209	651	0.318	0.283	ACSA_MYCTU Acetyl-coenzyme A synthetase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=acsA PE=1 SV=1
15	Q8ZKF6	2.19e-54	197	652	0.307	0.273	ACSA_SALTY Acetyl-coenzyme A synthetase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=acs PE=1 SV=1
16	P27550	1.04e-53	195	652	0.294	0.261	ACSA_ECOLI Acetyl-coenzyme A synthetase OS=Escherichia coli (strain K12) OX=83333 GN=acs PE=1 SV=2
17	Q99NB1	1.40e-50	187	682	0.273	0.232	ACS2L_MOUSE Acetyl-coenzyme A synthetase 2-like, mitochondrial OS=Mus musculus OX=10090 GN=Acss1 PE=1 SV=1
18	A4YGR1	1.72e-50	186	661	0.269	0.236	HPCAS_METS5 3-hydroxypropionyl-coenzyme A synthetase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2) OX=399549 GN=Msed_1456 PE=1 SV=1
19	Q973W5	4.42e-50	185	659	0.288	0.253	HPCAS_SULTO 3-hydroxypropionyl-coenzyme A synthetase OS=Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) OX=273063 GN=STK_07830 PE=1 SV=1
20	D3ZZN3	7.46e-49	182	682	0.269	0.229	D3ZZN3_RAT Acetyl-coenzyme A synthetase OS=Rattus norvegicus OX=10116 GN=Acss1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00501 AMP-binding	2.1e-76	268.9	AMP-binding enzyme
2	PF13193 AMP-binding_C	2.7e-19	81.2	AMP-binding enzyme C-terminal domain
3	PF10006 DUF2249	3.5e+02	12.5	Uncharacterized conserved protein (DUF2249)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000327916

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000278840	0.919	Fatty acid desaturase 2
2	9606.ENSP00000242592	0.907	Short-chain specific acyl-CoA dehydrogenase, mitochondrial
3	9606.ENSP00000440832	0.553	Calcium channel flower domain containing 1
4	9606.ENSP00000359216	0.501	Polypyrimidine tract-binding protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016878	1.000	acid-thiol ligase activity
GO:0016405	1.000	CoA-ligase activity
GO:0140657	0.965	ATP-dependent activity
GO:0015645	0.961	fatty acid ligase activity
GO:0005515	0.825	protein binding
GO:0016740	0.820	transferase activity
GO:0016747	0.714	acyltransferase activity, transferring groups other than amino-acyl groups
GO:0004467	0.658	long-chain fatty acid-CoA ligase activity
GO:0016408	0.602	C-acyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0008152	0.995	metabolic process
GO:0044237	0.994	cellular metabolic process
GO:0071704	0.993	organic substance metabolic process
GO:0044281	0.992	small molecule metabolic process
GO:0044238	0.992	primary metabolic process
GO:0006807	0.960	nitrogen compound metabolic process
GO:0006793	0.925	phosphorus metabolic process
GO:0019637	0.916	organophosphate metabolic process
GO:0006753	0.848	nucleoside phosphate metabolic process
GO:1901564	0.811	organonitrogen compound metabolic process
GO:0009117	0.799	nucleotide metabolic process
GO:0009259	0.767	ribonucleotide metabolic process
GO:0006637	0.755	acyl-CoA metabolic process
GO:0043436	0.606	oxoacid metabolic process
GO:0019752	0.589	carboxylic acid metabolic process
GO:0009058	0.522	biosynthetic process
GO:0006629	0.466	lipid metabolic process
GO:0006631	0.448	fatty acid metabolic process
GO:0065007	0.341	biological regulation
GO:1901576	0.336	organic substance biosynthetic process
GO:0044283	0.308	small molecule biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.997	mitochondrion
GO:0070013	0.818	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:6.2.1.-	1.000	Acid--thiol ligases.
EC:2.-.-.-	0.820	Transferases.
EC:2.3.1.-	0.714	Transferring groups other than amino-acyl groups.
RHEA:15421	0.658	a long-chain fatty acid + ATP + CoA = a long-chain fatty acyl-CoA + AMP + diphosphate
EC:6.2.1.3	0.658	long-chain-fatty-acid--CoA ligase.

[back to server]