StarFunc result for job id Q6NUN9

User Input

>input (644 residues)
MAEAVAAPISPWTMAATIQAMERKIESQAARLLSLEGRTGMAEKKLADCEKTAVEFGNQL
EGKWAVLGTLLQEYGLLQRRLENVENLLRNRNFWILRLPPGSKGESPKEWGKLEDWQKEL
YKHVMRGNYETLVSLDYAISKPEVLSQIEQGKEPCNWRRPGPKIPDVPVDPSPGSGPPVP
APDLLMQIKQEGELQLQEQQALGVEAWAAGQPDIGEEPWGLSQLDSGAGDISTDATSGVH
SNFSTTIPPTSWQTDLPPHHPSSACSDGTLKLNTAASTEDVKIVIKTEVQEEEVVATPVH
PTDLEAHGTLFGPGQATRFFPSPAQEGAWESQGSSFPSQDPVLGLREPARPERDMGELSP
AVAQEETPPGDWLFGGVRWGWNFRCKPPVGLNPRTGPEGLPYSSPDNGEAILDPSQAPRP
FNEPCKYPGRTKGFGHKPGLKKHPAAPPGGRPFTCATCGKSFQLQVSLSAHQRSCGAPDG
SGPGTGGGGSGSGGGGGGSGGGSARDGSALRCGECGRCFTRPAHLIRHRMLHTGERPFPC
TECEKRFTERSKLIDHYRTHTGVRPFTCTVCGKSFIRKDHLRKHQRNHAAGAKTPARGQP
LPTPPAPPDPFKSPASKGPLASTDLVTDWTCGLSVLGPTDGGDM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8YDQ5	0.161	0.158	1.272E-88	659	1.000	0.977	A0A2R8YDQ5.pdb.gz	A0A2R8YDQ5_HUMAN Zinc finger protein 746 OS=Homo sapiens OX=9606 GN=ZNF746 PE=1 SV=1
2	AFDB:Q9VED3	0.121	0.067	9.181E-7	1186	0.155	0.084	Q9VED3.pdb.gz	Q9VED3_DROME Stripe, isoform A OS=Drosophila melanogaster OX=7227 GN=sr PE=4 SV=1
3	AFDB:O43474	0.122	0.151	2.239E-6	513	0.135	0.170	O43474.pdb.gz	KLF4_HUMAN Krueppel-like factor 4 OS=Homo sapiens OX=9606 GN=KLF4 PE=1 SV=3
4	AFDB:Q5B154	0.112	0.100	9.685E-6	730	0.165	0.145	Q5B154.pdb.gz	Q5B154_EMENI C2H2-type domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05726 PE=4 SV=1
5	AFDB:O15062	0.083	0.079	3.461E-5	677	0.149	0.142	O15062.pdb.gz	ZBTB5_HUMAN Zinc finger and BTB domain-containing protein 5 OS=Homo sapiens OX=9606 GN=ZBTB5 PE=1 SV=1
6	AFDB:Q09838	0.118	0.112	3.461E-5	681	0.123	0.116	Q09838.pdb.gz	PRZ1_SCHPO Transcriptional regulator prz1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=prz1 PE=1 SV=1
7	AFDB:Q4WXZ7	0.112	0.093	6.973E-5	772	0.154	0.128	Q4WXZ7.pdb.gz	Q4WXZ7_ASPFU C2H2 transcription factor (Swi5), putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_3G11250 PE=4 SV=1
8	AFDB:Q4WPF5	0.096	0.099	3.651E-4	618	0.126	0.131	Q4WPF5.pdb.gz	SEBA_ASPFU C2H2 finger domain transcription factor sebA OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=sebA PE=4 SV=1
9	PDB:3w5kB	0.092	0.299	1.197E-3	110	0.064	0.373	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
10	AFDB:F1R419	0.101	0.067	1.391E-3	1060	0.165	0.100	F1R419.pdb.gz	F1R419_DANRE Apoptosis-stimulating of p53 protein 2 isoform X1 OS=Danio rerio OX=7955 GN=tp53bp2 PE=1 SV=1
11	AFDB:F1QWN1	0.066	0.045	1.794E-3	1063	0.182	0.110	F1QWN1.pdb.gz	F1QWN1_DANRE Tumor protein p53 binding protein, 2 isoform X1 OS=Danio rerio OX=7955 GN=si:dkeyp-34c12.2 PE=4 SV=2
12	PDB:7r5jV0	0.073	0.152	1.498	273	0.054	0.128	7r5jV0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
13	PDB:7r5jI0	0.093	0.262	3.216	173	0.037	0.139	7r5jI0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
14	PDB:5c8dE	0.032	0.056	4.149	280	0.019	0.043	5c8dE.pdb.gz	Structural basis for gene regulation by a B12-dependent photoreceptor.
15	PDB:4v60A	0.101	0.082	5.023	812	0.040	0.032	4v60A.pdb.gz
16	PDB:7c4jC	0.038	0.146	5.023	154	0.028	0.117	7c4jC.pdb.gz
17	PDB:7wttK	0.035	0.023	6.080	1022	0.020	0.013	7wttK.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
18	PDB:4cfgA	0.116	0.381	6.479	164	0.031	0.122	4cfgA.pdb.gz
19	PDB:7vvuP	0.045	0.085	6.479	270	0.014	0.033	7vvuP.pdb.gz	Structure of the NuA4 acetyltransferase complex bound to the nucleosome.
20	PDB:7z36B	0.107	0.144	6.479	446	0.033	0.047	7z36B.pdb.gz	Structure and functional mapping of the KRAB-KAP1 repressor complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8YDQ5	0.0	1301	659	1.000	0.977	A0A2R8YDQ5_HUMAN Zinc finger protein 746 OS=Homo sapiens OX=9606 GN=ZNF746 PE=1 SV=1
2	Q3U133	0.0	1164	652	0.930	0.919	ZN746_MOUSE Zinc finger protein 746 OS=Mus musculus OX=10090 GN=Znf746 PE=1 SV=3
3	Q6NUN9	0.0	1310	644	1.000	1.000	ZN746_HUMAN Zinc finger protein 746 OS=Homo sapiens OX=9606 GN=ZNF746 PE=1 SV=1
4	Q9ULD5	9.15e-108	346	831	0.376	0.291	ZN777_HUMAN Zinc finger protein 777 OS=Homo sapiens OX=9606 GN=ZNF777 PE=1 SV=3
5	B7Z3E8	4.61e-106	323	244	0.253	0.668	B7Z3E8_HUMAN cDNA FLJ51208 OS=Homo sapiens OX=9606 PE=1 SV=1
6	Q6ZMS7	2.68e-77	258	546	0.196	0.231	ZN783_HUMAN Zinc finger protein 783 OS=Homo sapiens OX=9606 GN=ZNF783 PE=1 SV=2
7	Q8TD17	1.17e-71	245	642	0.196	0.196	ZN398_HUMAN Zinc finger protein 398 OS=Homo sapiens OX=9606 GN=ZNF398 PE=1 SV=1
8	Q9UDV7	1.65e-69	240	671	0.191	0.183	ZN282_HUMAN Zinc finger protein 282 OS=Homo sapiens OX=9606 GN=ZNF282 PE=1 SV=3
9	A0A090N8N3	1.77e-63	220	495	0.171	0.222	A0A090N8N3_HUMAN Zinc finger protein 212 OS=Homo sapiens OX=9606 GN=ZNF212 PE=4 SV=1
10	Q9UDV6	1.77e-63	220	495	0.171	0.222	ZN212_HUMAN Zinc finger protein 212 OS=Homo sapiens OX=9606 GN=ZNF212 PE=1 SV=3
11	Q6ZPF1	3.53e-61	214	496	0.172	0.224	Q6ZPF1_MOUSE MKIAA3011 protein (Fragment) OS=Mus musculus OX=10090 GN=Zfp212 PE=2 SV=1
12	G3X8R7	4.48e-61	213	492	0.172	0.226	G3X8R7_MOUSE Zinc finger protein 212 OS=Mus musculus OX=10090 GN=Zfp212 PE=1 SV=1
13	Q6P238	4.90e-61	213	486	0.172	0.228	Q6P238_MOUSE Zinc finger protein 212 (Fragment) OS=Mus musculus OX=10090 GN=Zfp212 PE=2 SV=1
14	P51523	4.49e-33	137	738	0.210	0.183	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
15	Q96SK3	6.07e-30	127	696	0.211	0.195	ZN607_HUMAN Zinc finger protein 607 OS=Homo sapiens OX=9606 GN=ZNF607 PE=1 SV=3
16	Q8IZ26	9.84e-30	126	560	0.130	0.150	ZNF34_HUMAN Zinc finger protein 34 OS=Homo sapiens OX=9606 GN=ZNF34 PE=1 SV=3
17	A0A0C4DG42	1.12e-29	125	539	0.130	0.156	A0A0C4DG42_HUMAN Zinc finger protein 34 OS=Homo sapiens OX=9606 GN=ZNF34 PE=1 SV=1
18	Q15937	1.26e-29	125	498	0.134	0.173	ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens OX=9606 GN=ZNF79 PE=1 SV=2
19	P52742	1.36e-28	123	658	0.216	0.211	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
20	O94892	1.47e-27	120	652	0.196	0.193	ZN432_HUMAN Zinc finger protein 432 OS=Homo sapiens OX=9606 GN=ZNF432 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01352 KRAB	3.1e-06	38.0	KRAB box
2	PF00096 zf-C2H2	1.3e-15	68.0	Zinc finger, C2H2 type
3	PF16622 zf-C2H2_11	0.33	22.0	zinc-finger C2H2-type
4	PF13894 zf-C2H2_4	3.2e-07	41.6	C2H2-type zinc finger
5	PF13912 zf-C2H2_6	0.03	25.6	C2H2-type zinc finger
6	PF12171 zf-C2H2_jaz	0.041	25.4	Zinc-finger double-stranded RNA-binding
7	PF13465 zf-H2C2_2	7.2e-09	46.9	Zinc-finger double domain
8	PF12874 zf-met	0.01	27.4	Zinc-finger of C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000395007

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355865	0.769	E3 ubiquitin-protein ligase parkin
2	9606.ENSP00000338572	0.749	Zinc finger protein 212
3	9606.ENSP00000264867	0.686	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
4	9606.ENSP00000223029	0.654	Aminoacyl tRNA synthase complex-interacting multifunctional protein 2
5	9606.ENSP00000420418	0.632	Zinc finger protein 398
6	9606.ENSP00000276461	0.608	Erlin-2
7	9606.ENSP00000364204	0.595	Serine/threonine-protein kinase PINK1, mitochondrial
8	9606.ENSP00000248929	0.534	Small G protein signaling modulator 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031625	0.999	ubiquitin protein ligase binding
GO:0097159	0.970	organic cyclic compound binding
GO:1901363	0.969	heterocyclic compound binding
GO:0140110	0.941	transcription regulator activity
GO:0003690	0.927	double-stranded DNA binding
GO:0043565	0.819	sequence-specific DNA binding
GO:0003700	0.616	DNA-binding transcription factor activity
GO:1990837	0.441	sequence-specific double-stranded DNA binding
GO:0000981	0.388	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.305	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0080090	0.998	regulation of primary metabolic process
GO:0031323	0.998	regulation of cellular metabolic process
GO:0060255	0.996	regulation of macromolecule metabolic process
GO:0051171	0.996	regulation of nitrogen compound metabolic process
GO:0048523	0.992	negative regulation of cellular process
GO:0006355	0.991	regulation of DNA-templated transcription
GO:0048522	0.982	positive regulation of cellular process
GO:0031324	0.976	negative regulation of cellular metabolic process
GO:0051172	0.970	negative regulation of nitrogen compound metabolic process
GO:0010605	0.969	negative regulation of macromolecule metabolic process
GO:0031327	0.968	negative regulation of cellular biosynthetic process
GO:0006357	0.967	regulation of transcription by RNA polymerase II
GO:0010942	0.940	positive regulation of cell death
GO:0009987	0.922	cellular process
GO:0045892	0.915	negative regulation of DNA-templated transcription
GO:1901214	0.895	regulation of neuron death
GO:1901216	0.764	positive regulation of neuron death
GO:0009893	0.678	positive regulation of metabolic process
GO:0010604	0.614	positive regulation of macromolecule metabolic process
GO:0051173	0.608	positive regulation of nitrogen compound metabolic process
GO:0071840	0.541	cellular component organization or biogenesis
GO:0016043	0.497	cellular component organization
GO:0031325	0.463	positive regulation of cellular metabolic process
GO:0045935	0.433	positive regulation of nucleobase-containing compound metabolic process
GO:0031328	0.403	positive regulation of cellular biosynthetic process
GO:0045893	0.311	positive regulation of DNA-templated transcription
GO:0000122	0.309	negative regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005654	0.999	nucleoplasm
GO:0016020	0.357	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]