StarFunc result for job id Q6NUP7

User Input

>input (873 residues)
MHPPPPAAAMDFSQNSLFGYMEDLQELTIIERPVRRSLKTPEEIERLTVDEDLSDIERAV
YLLSAGQDVQGTSVIANLPFLMRQNPTETLRRVLPKVREALHVAGVEMQLTAAMSFLTIL
QDESVSIHAYTHSFLQVILLHLEHRDTGVSNAWLETLLSVIEVLPKETLRHEILNPLVSK
AQLSQTVQSRLVSCKILGKLTNKFDAHTIKREILPLVKSLCQDVEYEVRSCMCRQLENIA
QGIGTELTKSVVLPELIELSRDEGSSVRLAAFETLVNLLDIFDTDDRSQTILPLVKSFCE
KSFKADESILISLSFHLGKLCHGLYGIFTPDQHLRFLEFYKKLCTLGLQQENGHNENQIP
PQILEQEKKYISVRKNCAYNFPAMIVFVDPKNFHMELYSTFFCLCHDPEVPVRYTIAICF
YEVSKLLNSGVYLIHKELITLLQDESLEVLDALIDHLPEILELMSTGGESSVQENKLSSL
PDLIPALTAAEQRAAASLKWRTHEKLLQKYACLPHVISSDQIYYRFLQRMFTIMMTNNVL
PVQKAASRTLCIFLRYNRKQEQRHEVIQKLIEQLGQGKSYWNRLRFLDTCEFIIEIFSKS
FFCKYFFLPAIELTHDPVANVRMKLCYLLPKVKSTLKIPADKHLLQQLEMCVRKLLCQEK
DKDVLAIVKRTVLELDRMEMSMDAFQKKFYEKDLLDQEKEREELLLLEMEQLEKEKQQND
GRPMSDKMFEKKRRDTKTPTQSLPKNIPISVPGPSSVTPSTSKEIKKSKLIRSQSFNNQA
FHAKYGNLEKCASKSSTTGYTTSVSGLGKTSVLSLADDSFRTRNASSVPSSFSPNTPLPS
TSRGTGNSVDPKSSGSKDTQPRKATLKSRKSNP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8C0Y0	0.810	0.808	8.513E-80	875	0.911	0.909	Q8C0Y0.pdb.gz	PP4R4_MOUSE Serine/threonine-protein phosphatase 4 regulatory subunit 4 OS=Mus musculus OX=10090 GN=Ppp4r4 PE=1 SV=2
2	AFDB:Q385S3	0.591	0.648	3.492E-22	786	0.191	0.212	Q385S3.pdb.gz	Q385S3_TRYB2 Serine/threonine-protein phosphatase 4 regulatory subunit 4 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2560 PE=4 SV=1
3	PDB:1b3uA	0.422	0.590	8.963E-13	588	0.126	0.187	1b3uA.pdb.gz
4	PDB:7k36A	0.425	0.599	4.529E-10	554	0.117	0.184	7k36A.pdb.gz	Cryo-EM structure of the Hippo signaling integrator human STRIPAK.
5	PDB:3w3uA	0.326	0.287	1.710E-7	1030	0.103	0.087	3w3uA.pdb.gz
6	PDB:3nd2A	0.411	0.416	2.207E-7	861	0.109	0.110	3nd2A.pdb.gz
7	PDB:5gm6G	0.248	0.247	2.373E-7	875	0.126	0.126	5gm6G.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
8	AFDB:P87243	0.247	0.256	2.449E-7	828	0.123	0.129	P87243.pdb.gz	RIX1_SCHPO Pre-rRNA-processing protein rix1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rix1 PE=1 SV=1
9	PDB:6xu2A	0.334	0.280	2.746E-7	1091	0.101	0.081	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
10	PDB:1qgkA	0.328	0.327	4.098E-7	876	0.116	0.115	1qgkA.pdb.gz
11	PDB:4jlqA	0.347	0.358	4.571E-7	840	0.112	0.117	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
12	PDB:7unkA	0.245	0.212	5.686E-7	1047	0.117	0.097	7unkA.pdb.gz
13	PDB:2q5dB	0.283	0.290	8.183E-7	845	0.125	0.129	2q5dB.pdb.gz	Molecular Basis for the Recognition of Snurportin 1 by Importin {beta}.
14	AFDB:Q9XZ34	0.245	0.167	1.814E-6	1416	0.128	0.079	Q9XZ34.pdb.gz	RIF1_DROME Telomere-associated protein RIF1 OS=Drosophila melanogaster OX=7227 GN=Rif1 PE=1 SV=1
15	AFDB:O42874	0.211	0.133	4.345E-6	1462	0.141	0.084	O42874.pdb.gz	STU1_SCHPO Protein peg1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=peg1 PE=1 SV=1
16	AFDB:Q7Z3E5	0.165	0.174	2.586E-5	818	0.105	0.112	Q7Z3E5.pdb.gz	ARMC9_HUMAN LisH domain-containing protein ARMC9 OS=Homo sapiens OX=9606 GN=ARMC9 PE=1 SV=3
17	AFDB:Q8RWY6	0.266	0.176	2.992E-5	1439	0.150	0.091	Q8RWY6.pdb.gz	CLASP_ARATH CLIP-associated protein OS=Arabidopsis thaliana OX=3702 GN=CLASP PE=1 SV=1
18	AFDB:Q92540	0.096	0.082	3.967E-4	1137	0.118	0.091	Q92540.pdb.gz	SMG7_HUMAN Nonsense-mediated mRNA decay factor SMG7 OS=Homo sapiens OX=9606 GN=SMG7 PE=1 SV=2
19	AFDB:Q10669	0.149	0.102	6.604E-4	1587	0.123	0.067	Q10669.pdb.gz	MED23_CAEEL Mediator of RNA polymerase II transcription subunit 23 OS=Caenorhabditis elegans OX=6239 GN=sur-2 PE=1 SV=1
20	AFDB:F4J8G7	0.261	0.137	1.418E-3	2138	0.151	0.062	F4J8G7.pdb.gz	VIR_ARATH Protein virilizer homolog OS=Arabidopsis thaliana OX=3702 GN=VIR PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6NUP7	0.0	1799	873	1.000	1.000	PP4R4_HUMAN Serine/threonine-protein phosphatase 4 regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PPP4R4 PE=1 SV=1
2	Q8C0Y0	0.0	1650	875	0.911	0.909	PP4R4_MOUSE Serine/threonine-protein phosphatase 4 regulatory subunit 4 OS=Mus musculus OX=10090 GN=Ppp4r4 PE=1 SV=2
3	Q385S3	3.97e-30	130	786	0.196	0.218	Q385S3_TRYB2 Serine/threonine-protein phosphatase 4 regulatory subunit 4 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2560 PE=4 SV=1
4	Q38950	1.11e-07	57.8	587	0.045	0.066	2AAB_ARATH Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Arabidopsis thaliana OX=3702 GN=PP2AA2 PE=1 SV=2
5	Q38845	1.28e-06	54.7	588	0.042	0.063	2AAA_ARATH Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Arabidopsis thaliana OX=3702 GN=PP2AA1 PE=1 SV=1
6	Q54QR9	2.07e-06	53.9	584	0.061	0.091	2AAA_DICDI Protein phosphatase 2A scaffold subunit OS=Dictyostelium discoideum OX=44689 GN=pppA PE=1 SV=1
7	Q9UT08	6.00e-06	52.4	590	0.073	0.108	2AAA_SCHPO Protein phosphatase PP2A regulatory subunit A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=paa1 PE=1 SV=1
8	Q38951	6.35e-06	52.4	587	0.046	0.068	2AAG_ARATH Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A gamma isoform OS=Arabidopsis thaliana OX=3702 GN=PP2AA3 PE=1 SV=2
9	P30154	9.78e-06	51.6	601	0.111	0.161	2AAB_HUMAN Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Homo sapiens OX=9606 GN=PPP2R1B PE=1 SV=3
10	P36179	1.58e-05	50.8	591	0.033	0.049	2AAA_DROME Serine/threonine-protein phosphatase PP2A 65 kDa regulatory subunit OS=Drosophila melanogaster OX=7227 GN=Pp2A-29B PE=1 SV=4
11	F1MRS1	3.06e-04	47.0	893	0.068	0.066	F1MRS1_BOVIN Protein phosphatase 4 regulatory subunit 1 OS=Bos taurus OX=9913 GN=PPP4R1 PE=1 SV=3
12	Q32PI5	4.17e-04	46.2	589	0.039	0.058	2AAA_BOVIN Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Bos taurus OX=9913 GN=PPP2R1A PE=1 SV=1
13	A8K7B7	4.39e-04	46.2	589	0.039	0.058	A8K7B7_HUMAN Protein phosphatase 2 (Formerly 2A), regulatory subunit A (PR 65), alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R1A PE=1 SV=1
14	P30153	4.39e-04	46.2	589	0.039	0.058	2AAA_HUMAN Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R1A PE=1 SV=4
15	Q76MZ3	4.39e-04	46.2	589	0.039	0.058	2AAA_MOUSE Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Mus musculus OX=10090 GN=Ppp2r1a PE=1 SV=3
16	Q7TNP2	7.09e-04	45.8	601	0.039	0.057	2AAB_MOUSE Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Mus musculus OX=10090 GN=Ppp2r1b PE=1 SV=2
17	Q4GZ81	7.71e-04	45.4	573	0.104	0.159	Q4GZ81_TRYB2 Serine/threonine protein phosphatase 2a regulatory subunit, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.1380 PE=4 SV=1
18	A6MUT0	0.002	43.1	245	0.037	0.131	A6MUT0_GOSHI Protein phosphatase (Fragment) OS=Gossypium hirsutum OX=3635 PE=2 SV=1
19	G5ECH5	0.002	44.7	1562	0.064	0.036	PP4R1_CAEEL Serine/threonine-protein phosphatase 4 regulatory subunit 1 OS=Caenorhabditis elegans OX=6239 GN=ppfr-1 PE=1 SV=1
20	Q8TF05	0.009	42.4	950	0.065	0.060	PP4R1_HUMAN Serine/threonine-protein phosphatase 4 regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PPP4R1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02985 HEAT	3.6e-10	50.2	HEAT repeat
2	PF13646 HEAT_2	0.32	22.7	HEAT repeats
3	PF13513 HEAT_EZ	69	15.4	HEAT-like repeat
4	PF12333 Ipi1_N	7.3e+02	12.2	Rix1 complex component involved in 60S ribosome maturation
5	PF12755 Vac14_Fab1_bd	0.097	24.6	Vacuolar 14 Fab1-binding region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000305924

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000349124	0.987	Serine/threonine-protein phosphatase 4 regulatory subunit 2
2	9606.ENSP00000279387	0.980	Serine/threonine-protein phosphatase 4 catalytic subunit
3	9606.ENSP00000418447	0.957	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
4	9606.ENSP00000221138	0.950	Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
5	9606.ENSP00000325074	0.947	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform
6	9606.ENSP00000412324	0.945	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform
7	9606.ENSP00000377036	0.943	Serine/threonine-protein phosphatase 2A activator
8	9606.ENSP00000261461	0.942	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform
9	9606.ENSP00000383402	0.942	Serine/threonine-protein phosphatase 4 regulatory subunit 1
10	9606.ENSP00000341779	0.939	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
11	9606.ENSP00000326031	0.936	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
12	9606.ENSP00000378769	0.934	Serine/threonine-protein phosphatase PP1-beta catalytic subunit
13	9606.ENSP00000378323	0.932	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform
14	9606.ENSP00000378306	0.929	Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform
15	9606.ENSP00000324804	0.909	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform
16	9606.ENSP00000477868	0.908	TOX high mobility group box family member 4
17	9606.ENSP00000478767	0.905	Neurabin-2
18	9606.ENSP00000234310	0.903	Calcineurin subunit B type 1
19	9606.ENSP00000389168	0.903	Protein phosphatase 1 regulatory subunit 12A
20	9606.ENSP00000307786	0.902	Cytochrome c

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0031323	0.988	regulation of cellular metabolic process
GO:0080090	0.985	regulation of primary metabolic process
GO:0060255	0.985	regulation of macromolecule metabolic process
GO:0051171	0.982	regulation of nitrogen compound metabolic process
GO:0035303	0.979	regulation of dephosphorylation
GO:0051246	0.970	regulation of protein metabolic process
GO:0048523	0.968	negative regulation of cellular process
GO:0065009	0.958	regulation of molecular function
GO:0035304	0.951	regulation of protein dephosphorylation
GO:0044092	0.947	negative regulation of molecular function
GO:0045936	0.933	negative regulation of phosphate metabolic process
GO:0050790	0.928	regulation of catalytic activity
GO:0031400	0.926	negative regulation of protein modification process
GO:0043086	0.909	negative regulation of catalytic activity
GO:0051346	0.882	negative regulation of hydrolase activity
GO:0035305	0.876	negative regulation of dephosphorylation
GO:0010921	0.859	regulation of phosphatase activity
GO:0043666	0.715	regulation of phosphoprotein phosphatase activity
GO:0035308	0.668	negative regulation of protein dephosphorylation
GO:0032501	0.461	multicellular organismal process
GO:0010923	0.435	negative regulation of phosphatase activity
GO:0009987	0.395	cellular process
GO:0048856	0.379	anatomical structure development
GO:0007275	0.313	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0008287	0.997	protein serine/threonine phosphatase complex
GO:0043226	0.914	organelle
GO:0043227	0.901	membrane-bounded organelle
GO:0043231	0.834	intracellular membrane-bounded organelle
GO:0043233	0.373	organelle lumen
GO:0005634	0.366	nucleus
GO:0070013	0.362	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]