StarFunc result for job id Q6NUQ1

User Input

>input (792 residues)
MLPAGEIGASPAAPCCSESGDERKNLEEKSDINVTVLIGSKQVSEGTDNGDLPSYVSAFI
EKEVGNDLKSLKKLDKLIEQRTVSKMQLEEQVLTISSEIPKRIRSALKNAEESKQFLNQF
LEQETHLFSAINSHLLTAQPWMDDLGTMISQIEEIERHLAYLKWISQIEELSDNIQQYLM
TNNVPEAASTLVSMAELDIKLQESSCTHLLGFMRATVKFWHKILKDKLTSDFEEILAQLH
WPFIAPPQSQTVGLSRPASAPEIYSYLETLFCQLLKLQTSDELLTEPKQLPEKYSLPASP
SVILPIQVMLTPLQKRFRYHFRGNRQTNVLSKPEWYLAQVLMWIGNHTEFLDEKIQPILD
KVGSLVNARLEFSRGLMMLVLEKLATDIPCLLYDDNLFCHLVDEVLLFERELHSVHGYPG
TFASCMHILSEETCFQRWLTVERKFALQKMDSMLSSEAAWVSQYKDITDVDEMKVPDCAE
TFMTLLLVITDRYKNLPTASRKLQFLELQKDLVDDFRIRLTQVMKEETRASLGFRYCAIL
NAVNYISTVLADWADNVFFLQLQQAALEVFAENNTLSKLQLGQLASMESSVFDDMINLLE
RLKHDMLTRQVDHVFREVKDAAKLYKKERWLSLPSQSEQAVMSLSSSACPLLLTLRDHLL
QLEQQLCFSLFKIFWQMLVEKLDVYIYQEIILANHFNEGGAAQLQFDMTRNLFPLFSHYC
KRPENYFKHIKEACIVLNLNVGSALLLKDVLQSASGQLPATAALNEVGIYKLAQQDVEIL
LNLRTNWPNTGK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6NUQ1	1.000	1.000	6.636E-96	792	1.000	1.000	Q6NUQ1.pdb.gz	RINT1_HUMAN RAD50-interacting protein 1 OS=Homo sapiens OX=9606 GN=RINT1 PE=1 SV=1
2	AFDB:Q9VS46	0.707	0.770	7.731E-37	724	0.265	0.290	Q9VS46.pdb.gz	RINT1_DROME RINT1-like protein OS=Drosophila melanogaster OX=7227 GN=Rint1 PE=2 SV=2
3	AFDB:Q9STU3	0.528	0.526	7.180E-22	795	0.181	0.180	Q9STU3.pdb.gz	MAG2_ARATH RINT1-like protein MAG2 OS=Arabidopsis thaliana OX=3702 GN=MAG2 PE=1 SV=1
4	AFDB:Q8GXP1	0.536	0.529	3.583E-20	804	0.172	0.169	Q8GXP1.pdb.gz	MAG2L_ARATH RINT1-like protein MAG2L OS=Arabidopsis thaliana OX=3702 GN=MAG2L PE=2 SV=1
5	AFDB:Q0WQF4	0.366	0.354	6.903E-14	828	0.116	0.111	Q0WQF4.pdb.gz	VP53A_ARATH Vacuolar protein sorting-associated protein 53 A OS=Arabidopsis thaliana OX=3702 GN=VPS53 PE=1 SV=1
6	AFDB:P34561	0.322	0.321	4.387E-12	798	0.129	0.128	P34561.pdb.gz	VPS53_CAEEL Vacuolar protein sorting-associated protein 53 homolog OS=Caenorhabditis elegans OX=6239 GN=vps-53 PE=1 SV=4
7	PDB:3fhnA	0.484	0.556	2.206E-11	673	0.122	0.144	3fhnA.pdb.gz
8	AFDB:Q8L838	0.398	0.420	8.662E-11	738	0.138	0.148	Q8L838.pdb.gz	COG4_ARATH Conserved oligomeric Golgi complex subunit 4 OS=Arabidopsis thaliana OX=3702 GN=COG4 PE=1 SV=1
9	AFDB:O35382	0.293	0.249	1.149E-10	975	0.138	0.112	O35382.pdb.gz	EXOC4_MOUSE Exocyst complex component 4 OS=Mus musculus OX=10090 GN=Exoc4 PE=1 SV=2
10	AFDB:D3ZPE5	0.368	0.355	1.523E-10	832	0.124	0.118	D3ZPE5.pdb.gz	D3ZPE5_RAT Vacuolar protein sorting-associated protein 53 homolog OS=Rattus norvegicus OX=10116 GN=Vps53 PE=1 SV=1
11	AFDB:Q94AI6	0.290	0.302	2.189E-10	752	0.120	0.126	Q94AI6.pdb.gz	SEC6_ARATH Exocyst complex component SEC6 OS=Arabidopsis thaliana OX=3702 GN=SEC6 PE=1 SV=1
12	PDB:5yfpC	0.296	0.296	2.957E-5	794	0.141	0.141	5yfpC.pdb.gz
13	PDB:5yfpE	0.247	0.251	3.320E-4	776	0.115	0.117	5yfpE.pdb.gz
14	PDB:7qpgW	0.288	0.291	4.772E-4	779	0.125	0.127	7qpgW.pdb.gz
15	PDB:7qenD	0.165	0.135	7.399E-3	1050	0.120	0.090	7qenD.pdb.gz	A hold-and-feed mechanism drives directional DNA loop extrusion by condensin.
16	PDB:7tyrA	0.089	0.038	8.693E-3	3905	0.111	0.023	7tyrA.pdb.gz
17	PDB:6ttuC	0.201	0.217	1.153E-2	701	0.081	0.091	6ttuC.pdb.gz	NEDD8 nucleates a multivalent cullin-RING-UBE2D ubiquitin ligation assembly.
18	PDB:7r5jK0	0.097	0.084	1.153E-2	1086	0.105	0.076	7r5jK0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
19	PDB:6fvbA	0.121	0.104	1.200E-2	1001	0.093	0.074	6fvbA.pdb.gz
20	PDB:4bujB	0.096	0.072	1.468E-2	1367	0.098	0.057	4bujB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6NUQ1	0.0	1632	792	1.000	1.000	RINT1_HUMAN RAD50-interacting protein 1 OS=Homo sapiens OX=9606 GN=RINT1 PE=1 SV=1
2	Q9VS46	1.98e-95	315	724	0.284	0.311	RINT1_DROME RINT1-like protein OS=Drosophila melanogaster OX=7227 GN=Rint1 PE=2 SV=2
3	Q9STU3	3.12e-14	79.3	795	0.152	0.151	MAG2_ARATH RINT1-like protein MAG2 OS=Arabidopsis thaliana OX=3702 GN=MAG2 PE=1 SV=1
4	Q9C0W8	9.26e-10	64.7	678	0.077	0.090	TIP20_SCHPO Protein transport protein tip20 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tip20 PE=3 SV=1
5	Q8GXP1	8.33e-09	61.6	804	0.154	0.152	MAG2L_ARATH RINT1-like protein MAG2L OS=Arabidopsis thaliana OX=3702 GN=MAG2L PE=2 SV=1
6	P33891	0.64	35.8	701	0.119	0.134	TIP20_YEAST Protein transport protein TIP20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIP20 PE=1 SV=1
7	Q9DBB9	0.65	35.8	547	0.035	0.051	CPN2_MOUSE Carboxypeptidase N subunit 2 OS=Mus musculus OX=10090 GN=Cpn2 PE=1 SV=2
8	Q9X1X1	4.6	33.1	852	0.048	0.045	RAD50_THEMA Probable DNA double-strand break repair Rad50 ATPase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=rad50 PE=1 SV=1
9	Q96326	8.8	31.6	256	0.023	0.070	CCME_ARATH Cytochrome c-type biogenesis protein CcmE homolog, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=CCME PE=1 SV=1
10	Q6WZD3	9.7	32.0	458	0.038	0.066	Q6WZD3_DANRE Nogo receptor homolog 1a OS=Danio rerio OX=7955 GN=ngrh1a PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04437 RINT1_TIP1	9.2e-129	442.2	RINT-1 / TIP-1 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000257700

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000200135	0.999	Centromere/kinetochore protein zw10 homolog
2	9606.ENSP00000305810	0.999	Syntaxin-18
3	9606.ENSP00000281513	0.998	Neuroblastoma-amplified sequence
4	9606.ENSP00000263897	0.993	Vesicle transport protein USE1
5	9606.ENSP00000231668	0.980	BCL2/adenovirus E1B 19kDa interacting protein 1
6	9606.ENSP00000463393	0.961	Vesicle-trafficking protein SEC22b
7	9606.ENSP00000397394	0.953	UPF0449 protein C19orf25
8	9606.ENSP00000478479	0.931	Ras-related protein Rab-18
9	9606.ENSP00000384182	0.895	Sec1 family domain-containing protein 2
10	9606.ENSP00000264028	0.853	Coatomer subunit delta
11	9606.ENSP00000262133	0.848	Retinoblastoma-like protein 2
12	9606.ENSP00000368100	0.836	DNA repair protein RAD50
13	9606.ENSP00000258654	0.833	Conserved oligomeric Golgi complex subunit 3
14	9606.ENSP00000315775	0.829	Conserved oligomeric Golgi complex subunit 4
15	9606.ENSP00000311429	0.804	Protein zwilch homolog
16	9606.ENSP00000329419	0.799	Coatomer subunit beta
17	9606.ENSP00000348455	0.790	UV radiation resistance-associated gene protein
18	9606.ENSP00000401435	0.778	Vacuolar protein sorting-associated protein 53 homolog
19	9606.ENSP00000390783	0.762	Sec1 family domain-containing protein 1
20	9606.ENSP00000299886	0.753	Conserved oligomeric Golgi complex subunit 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006974	0.985	cellular response to DNA damage stimulus
GO:0065007	0.978	biological regulation
GO:0010389	0.969	regulation of G2/M transition of mitotic cell cycle
GO:0044773	0.968	mitotic DNA damage checkpoint signaling
GO:1902750	0.965	negative regulation of cell cycle G2/M phase transition
GO:0010972	0.964	negative regulation of G2/M transition of mitotic cell cycle
GO:0060341	0.956	regulation of cellular localization
GO:0007095	0.942	mitotic G2 DNA damage checkpoint signaling
GO:0051049	0.926	regulation of transport
GO:0032386	0.903	regulation of intracellular transport
GO:0060627	0.881	regulation of vesicle-mediated transport
GO:0051179	0.618	localization
GO:0051234	0.586	establishment of localization
GO:0051641	0.498	cellular localization
GO:0016192	0.491	vesicle-mediated transport
GO:0048193	0.482	Golgi vesicle transport
GO:0051649	0.448	establishment of localization in cell
GO:0071840	0.409	cellular component organization or biogenesis
GO:0016043	0.389	cellular component organization
GO:0046907	0.359	intracellular transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0099023	0.999	vesicle tethering complex
GO:0005829	0.999	cytosol
GO:0140534	0.997	endoplasmic reticulum protein-containing complex
GO:0016020	0.959	membrane
GO:0031090	0.908	organelle membrane
GO:0031982	0.869	vesicle
GO:0031984	0.804	organelle subcompartment
GO:0070939	0.727	Dsl1/NZR complex
GO:0005794	0.624	Golgi apparatus
GO:0043232	0.403	intracellular non-membrane-bounded organelle
GO:0098588	0.353	bounding membrane of organelle
GO:0031981	0.341	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]