StarFunc result for job id Q6NV74

User Input

>input (962 residues)
MISTRVMDIKLREAAEGLGEDSTGKKKSKFKTFKKFFGKKKRKESPSSTGSSTWKQSQTR
NEVIAIESGPVGYDSEDELEESRGTLGSRALSHDSIFIPESGQDATRPVRVFSQENVCDR
IKALQLKIQCNVKMGPPPPPGGLPAKRGEDAGMSSEDDGLPRSPPEMSLLHDVGPGTTIK
VSVVSPDHVSDSTVSARISDNSLAPVADFSYPAESSSCLDNSAAKHKLQVKPRNQRSSKM
RRLSSRAQSESLSDLTCTPEEEENEEKPLLEVSPEERPSSGQQDVAPDRGPEPGPPAPLP
PPGGARARRARLQHSSALTASVEEGGVPGEDPSSRPATPELAEPESAPTLRVEPPSPPEG
PPNPGPDGGKQDGEAPPAGPCAPATDKAEEVVCAPEDVASPFPTAIPEGDTTPPETDPAA
TSEAPSARDGPERSVPKEAEPTPPVLPDEEKGPPGPAPEPEREAETEPERGAGTEPERIG
TEPSTAPAPSPPAPKSCLKHRPAAASEGPAASPPLAAAESPPVEPGPGSLDAEAAAPERP
KAERAEAPPAGAERAAPERKAERGGAELRGAKKFSVSSCRARPRPGVSRPLERASGRLPL
ARSGPVWRSEAALDDLQGLPEPQHAKPGPRKLAERGPQDSGDRAASPAGPRKSPQEAAAA
PGTREPCPAAQEPAPSEDRNPFPVKLRSTSLSLKYRDGASQEVKGVKRYSAEVRLERSLT
VLPKEEKCPLGTAPALRGTRAPSDQGKGKARPPEPLSSKPPLPRKPLLQSFTLPHQPAPP
DAGPGEREPRKEPRTAEKRPLRRGAEKSLPPAATGPGADGQPAPPWITVTRQKRRGTLDQ
PPNQEDKPGARTLKSEPGKQAKVPERGQEPVKQADFVRSKSFLITPVKPAVDRKQGAKLN
FKEGLQRGISLSHQNLAQSAVMMEKELHQLKRASYASTDQPSWMELARKKSQAWSDMPQI
IK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q69ZZ9	0.046	0.045	1.110E-2	979	0.168	0.165	Q69ZZ9.pdb.gz	K0754_MOUSE Microtubule-actin cross-linking factor 1, isoforms 6/7 OS=Mus musculus OX=10090 GN=Macf1 PE=2 SV=3
2	AFDB:Q10280	0.042	0.045	1.405E-2	855	0.127	0.143	Q10280.pdb.gz	GAF1_SCHPO Transcription factor gaf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gaf1 PE=1 SV=2
3	AFDB:P20482	0.048	0.038	3.614E-2	1383	0.157	0.109	P20482.pdb.gz	CNC_DROME Segmentation protein cap'n'collar OS=Drosophila melanogaster OX=7227 GN=cnc PE=2 SV=3
4	AFDB:Q96EV2	0.041	0.036	4.230E-2	1170	0.169	0.139	Q96EV2.pdb.gz	RBM33_HUMAN RNA-binding protein 33 OS=Homo sapiens OX=9606 GN=RBM33 PE=1 SV=3
5	AFDB:A7UMX5	0.042	0.040	4.951E-2	996	0.169	0.164	A7UMX5.pdb.gz	A7UMX5_MELGA Synaptopodin 2 variant OS=Meleagris gallopavo OX=9103 PE=2 SV=1
6	AFDB:Q6UB99	0.044	0.022	5.794E-2	2663	0.188	0.068	Q6UB99.pdb.gz	ANR11_HUMAN Ankyrin repeat domain-containing protein 11 OS=Homo sapiens OX=9606 GN=ANKRD11 PE=1 SV=3
7	AFDB:A0A2R8YDD6	0.036	0.038	1.087E-1	892	0.150	0.161	A0A2R8YDD6.pdb.gz	A0A2R8YDD6_HUMAN Ataxin 7 OS=Homo sapiens OX=9606 GN=ATXN7 PE=1 SV=1
8	AFDB:Q9GMD3	0.052	0.053	1.087E-1	934	0.152	0.156	Q9GMD3.pdb.gz	Q9GMD3_BOVIN Retinitis pigmentosa GTPase regulator (Fragment) OS=Bos taurus OX=9913 GN=RPGR PE=1 SV=1
9	AFDB:Q9GV71	0.036	0.028	1.377E-1	1543	0.106	0.066	Q9GV71.pdb.gz	Q9GV71_DICDI MAP kinase phosphatase OS=Dictyostelium discoideum OX=44689 GN=mkpA PE=4 SV=1
10	AFDB:Q9H0B3	0.042	0.036	1.377E-1	1180	0.161	0.131	Q9H0B3.pdb.gz	IQCN_HUMAN IQ domain-containing protein N OS=Homo sapiens OX=9606 GN=IQCN PE=1 SV=1
11	PDB:7edxl	0.023	0.138	7.510	107	0.007	0.065	7edxl.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
12	PDB:5nrlG	0.025	0.056	8.790	372	0.010	0.027	5nrlG.pdb.gz	Structure of a pre-catalytic spliceosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5PR69	1.61e-17	90.5	1291	0.067	0.050	CRACD_MOUSE Capping protein-inhibiting regulator of actin dynamics OS=Mus musculus OX=10090 GN=Cracd PE=1 SV=4
2	Q6ZU35	5.56e-17	89.0	1233	0.064	0.050	CRACD_HUMAN Capping protein-inhibiting regulator of actin dynamics OS=Homo sapiens OX=9606 GN=CRACD PE=1 SV=3
3	E9Q0C6	0.10	39.3	1637	0.022	0.013	K1210_MOUSE Acrosomal protein KIAA1210 OS=Mus musculus OX=10090 GN=Kiaa1210 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15262 DUF4592	4.9e-28	109.5	Domain of unknown function (DUF4592)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000380996

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000335595	0.763	T-complex protein 11-like protein 1
2	9606.ENSP00000225726	0.736	Involved in the regulation of calcium ion homeostasis in the endoplasmic reticulum . Required for proper protein degradation via the ERAD pathway . Has an essential role in the maintenance of endoplasmic reticulum organization during embryogenesis (By similarity)
3	9606.ENSP00000348959	0.590	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.949	cellular process
GO:0050789	0.837	regulation of biological process
GO:0050794	0.825	regulation of cellular process
GO:0071840	0.476	cellular component organization or biogenesis
GO:0016043	0.440	cellular component organization
GO:0050896	0.370	response to stimulus
GO:0048519	0.358	negative regulation of biological process
GO:0048518	0.341	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	1.000	intracellular organelle
GO:0005737	0.982	cytoplasm
GO:0043227	0.944	membrane-bounded organelle
GO:0016020	0.857	membrane
GO:0043231	0.830	intracellular membrane-bounded organelle
GO:0031982	0.771	vesicle
GO:0043232	0.765	intracellular non-membrane-bounded organelle
GO:0012505	0.548	endomembrane system
GO:0005856	0.507	cytoskeleton
GO:0015629	0.454	actin cytoskeleton
GO:0071944	0.426	cell periphery
GO:0005886	0.353	plasma membrane
GO:0005576	0.346	extracellular region
GO:0005829	0.308	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]