StarFunc result for job id Q6NVH7

User Input

>input (229 residues)
MPAAGPPLLLLGTPGSGKTALLFAAALEAAGEGQGPVLFLTRRPLQSMPRGTGTTLDPMR
LQKIRFQYPPSTRELFRLLCSAHEAPGPAPSLLLLDGLEEYLAEDPEPQEAAYLIALLLD
TAAHFSHRLGPGRDCGLMVALQTQEEAGSGDVLHLALLQRYFPAQCWLQPDAPGPGEHGL
RACLEPGGLGPRTEWWVTFRSDGEMMIAPWPTQAGDPSSGKGSSSGGQP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6NVH7	1.000	1.000	9.475E-50	229	1.000	1.000	Q6NVH7.pdb.gz	SWAP1_HUMAN ATPase SWSAP1 OS=Homo sapiens OX=9606 GN=SWSAP1 PE=1 SV=1
2	PDB:7ej6B	0.582	0.437	4.011E-9	316	0.127	0.092	7ej6B.pdb.gz	Mechanisms of distinctive mismatch tolerance between Rad51 and Dmc1 in homologous recombination.
3	AFDB:O15315	0.639	0.403	6.861E-9	384	0.162	0.096	O15315.pdb.gz	RA51B_HUMAN DNA repair protein RAD51 homolog 2 OS=Homo sapiens OX=9606 GN=RAD51B PE=1 SV=2
4	AFDB:Q99L85	0.590	0.467	7.767E-9	300	0.153	0.117	Q99L85.pdb.gz	ELP5_MOUSE Elongator complex protein 5 OS=Mus musculus OX=10090 GN=Elp5 PE=2 SV=1
5	AFDB:Q9CX47	0.626	0.525	1.445E-8	278	0.179	0.147	Q9CX47.pdb.gz	XRCC2_MOUSE DNA repair protein XRCC2 OS=Mus musculus OX=10090 GN=Xrcc2 PE=1 SV=1
6	AFDB:Q557E6	0.603	0.412	1.852E-8	351	0.166	0.108	Q557E6.pdb.gz	Q557E6_DICDI DNA repair protein RAD51 homolog OS=Dictyostelium discoideum OX=44689 GN=DDB_G0273139 PE=3 SV=1
7	AFDB:C8VSQ3	0.586	0.403	1.970E-8	348	0.153	0.101	C8VSQ3.pdb.gz	C8VSQ3_EMENI DNA repair protein RAD51 homolog OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_01237 PE=3 SV=1
8	AFDB:Q95Q25	0.604	0.370	2.231E-8	395	0.148	0.086	Q95Q25.pdb.gz	Q95Q25_CAEEL DNA repair protein RAD51 homolog OS=Caenorhabditis elegans OX=6239 GN=rad-51 PE=1 SV=1
9	AFDB:Q5TYR1	0.587	0.412	2.374E-8	340	0.157	0.106	Q5TYR1.pdb.gz	Q5TYR1_DANRE DNA repair protein RAD51 homolog OS=Danio rerio OX=7955 GN=wu:fb38e12 PE=1 SV=1
10	AFDB:Q14565	0.580	0.407	3.237E-8	340	0.166	0.112	Q14565.pdb.gz	DMC1_HUMAN Meiotic recombination protein DMC1/LIM15 homolog OS=Homo sapiens OX=9606 GN=DMC1 PE=1 SV=2
11	AFDB:Q682D3	0.543	0.353	3.237E-8	372	0.192	0.118	Q682D3.pdb.gz	XRCC2_ARATH DNA repair protein XRCC2 homolog OS=Arabidopsis thaliana OX=3702 GN=XRCC2 PE=2 SV=2
12	PDB:7c98A	0.614	0.467	6.967E-8	309	0.170	0.126	7c98A.pdb.gz	Identification of fidelity-governing factors in human recombinases DMC1 and RAD51 from cryo-EM structures.
13	PDB:1xp8A	0.573	0.455	4.484E-7	298	0.135	0.104	1xp8A.pdb.gz	Crystal structure of RecA from Deinococcus radiodurans: insights into the structural basis of extreme radioresistance.
14	PDB:3cmtD	0.538	0.093	4.484E-7	1609	0.140	0.020	3cmtD.pdb.gz	Mechanism of homologous recombination from the RecA-ssDNA/dsDNA structures.
15	PDB:1xu4A	0.575	0.426	5.401E-7	318	0.175	0.126	1xu4A.pdb.gz	Crystal structure of an ATPase-active form of Rad51 homolog from Methanococcus voltae. Insights into potassium dependence
16	PDB:3ldaA	0.558	0.448	6.507E-7	293	0.140	0.109	3ldaA.pdb.gz
17	PDB:4ejsC	0.518	0.452	6.507E-7	271	0.096	0.081	4ejsC.pdb.gz
18	PDB:1xmvA	0.526	0.424	7.838E-7	293	0.118	0.092	1xmvA.pdb.gz	Crystal Structures of Escherichia coli RecA in Complex with MgADP and MnAMP-PNP(,).
19	PDB:2r6eA	0.614	0.383	1.069E-6	387	0.122	0.072	2r6eA.pdb.gz
20	PDB:4nmnA	0.571	0.332	1.869E-6	425	0.175	0.094	4nmnA.pdb.gz	Nucleotide and partner-protein control of bacterial replicative helicase structure and function.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6NVH7	7.59e-163	451	229	1.000	1.000	SWAP1_HUMAN ATPase SWSAP1 OS=Homo sapiens OX=9606 GN=SWSAP1 PE=1 SV=1
2	Q4QPP5	0.30	34.7	673	0.157	0.053	Q4QPP5_DROME Katanin p60 ATPase-containing subunit A1 OS=Drosophila melanogaster OX=7227 GN=kat-60L1 PE=2 SV=1
3	Q9VNI0	0.31	34.3	669	0.157	0.054	Q9VNI0_DROME Katanin p60 ATPase-containing subunit A1 OS=Drosophila melanogaster OX=7227 GN=kat-60L1 PE=2 SV=1
4	E1JJ62	0.39	34.3	609	0.157	0.059	E1JJ62_DROME Katanin p60 ATPase-containing subunit A1 OS=Drosophila melanogaster OX=7227 GN=kat-60L1 PE=3 SV=1
5	Q961H1	0.39	34.3	605	0.157	0.060	Q961H1_DROME Katanin p60 ATPase-containing subunit A1 OS=Drosophila melanogaster OX=7227 GN=kat-60L1 PE=2 SV=1
6	P45444	0.65	33.5	4345	0.070	0.004	DYHC_EMENI Dynein heavy chain, cytoplasmic OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=nudA PE=3 SV=2
7	Q2U6C3	0.65	33.5	4346	0.070	0.004	Q2U6C3_ASPOR Dynein heavy chain, cytoplasmic OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090120000298 PE=4 SV=1
8	O59824	0.86	33.1	709	0.131	0.042	YME1_SCHPO ATP-dependent zinc metalloprotease YME1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC965.04c PE=3 SV=1
9	O53348	0.88	33.1	1055	0.083	0.018	O53348_MYCTU DNA 3'-5' helicase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv3202c PE=1 SV=2
10	Q386D8	1.1	32.7	437	0.122	0.064	Q386D8_TRYB2 Proteasome regulatory ATPase subunit 2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.1220 PE=3 SV=1
11	Q84WU8	1.1	32.7	809	0.122	0.035	FTSH3_ARATH ATP-dependent zinc metalloprotease FTSH 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=FTSH3 PE=1 SV=1
12	P48736	1.2	32.7	1102	0.122	0.025	PK3CG_HUMAN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform OS=Homo sapiens OX=9606 GN=PIK3CG PE=1 SV=3
13	Q8SZ40	1.2	32.7	572	0.148	0.059	Q8SZ40_DROME Katanin p60 ATPase-containing subunit A1 OS=Drosophila melanogaster OX=7227 GN=Kat60 PE=2 SV=1
14	Q9VN89	1.2	32.7	572	0.148	0.059	Q9VN89_DROME Katanin p60 ATPase-containing subunit A1 OS=Drosophila melanogaster OX=7227 GN=Kat60 PE=2 SV=2
15	A0A0B4KFL3	1.3	32.3	605	0.148	0.056	A0A0B4KFL3_DROME Katanin p60 ATPase-containing subunit A1 OS=Drosophila melanogaster OX=7227 GN=Kat60 PE=3 SV=1
16	Q4GZ96	1.3	32.3	480	0.083	0.040	Q4GZ96_TRYB2 Chaperone protein DNAJ, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.1230 PE=4 SV=1
17	Q8K0T4	1.4	32.3	488	0.162	0.076	KATL1_MOUSE Katanin p60 ATPase-containing subunit A-like 1 OS=Mus musculus OX=10090 GN=Katnal1 PE=1 SV=1
18	Q9BW62	1.4	32.3	490	0.162	0.076	KATL1_HUMAN Katanin p60 ATPase-containing subunit A-like 1 OS=Homo sapiens OX=9606 GN=KATNAL1 PE=1 SV=1
19	O88967	1.5	32.3	715	0.118	0.038	YMEL1_MOUSE ATP-dependent zinc metalloprotease YME1L1 OS=Mus musculus OX=10090 GN=Yme1l1 PE=1 SV=1
20	Q96TA2	1.5	32.3	773	0.118	0.035	YMEL1_HUMAN ATP-dependent zinc metalloprotease YME1L1 OS=Homo sapiens OX=9606 GN=YME1L1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	55	15.6	ATPase family associated with various cellular activities (AAA)
2	PF13191 AAA_16	3.3	19.5	AAA ATPase domain
3	PF13245 AAA_19	4.1e+02	12.6	AAA domain
4	PF13401 AAA_22	3.7e+02	12.8	AAA domain
5	PF13481 AAA_25	75	14.3	AAA domain
6	PF01695 IstB_IS21	7.6e+02	11.0	IstB-like ATP binding protein
7	PF05729 NACHT	0.021	26.2	NACHT domain
8	PF01970 TctA	9.4e+02	9.9	Tripartite tricarboxylate transporter TctA family
9	PF06414 Zeta_toxin	9.1e+02	10.6	Zeta toxin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000310008

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000382218	0.996	Zinc finger SWIM domain-containing protein 7
2	9606.ENSP00000310520	0.903	DNA repair endonuclease XPF
3	9606.ENSP00000360682	0.903	Protein PAXX
4	9606.ENSP00000233146	0.902	DNA mismatch repair protein Msh2
5	9606.ENSP00000234420	0.902	DNA mismatch repair protein Msh6
6	9606.ENSP00000375978	0.902	X-ray repair cross-complementing protein 5
7	9606.ENSP00000406046	0.902	DNA polymerase delta catalytic subunit
8	9606.ENSP00000013807	0.900	DNA excision repair protein ERCC-1
9	9606.ENSP00000262241	0.900	REST corepressor 1
10	9606.ENSP00000265038	0.900	DNA excision repair protein ERCC-8
11	9606.ENSP00000278616	0.900	Serine-protein kinase ATM
12	9606.ENSP00000285021	0.900	DNA repair protein complementing XP-C cells
13	9606.ENSP00000300145	0.900	Mitochondrial inner membrane protease ATP23 homolog
14	9606.ENSP00000313420	0.900	DNA-dependent protein kinase catalytic subunit
15	9606.ENSP00000347978	0.900	DNA repair protein complementing XP-G cells
16	9606.ENSP00000349313	0.900	Non-homologous end-joining factor 1
17	9606.ENSP00000350708	0.900	UV excision repair protein RAD23 homolog B
18	9606.ENSP00000352257	0.900	X-ray repair cross-complementing protein 6
19	9606.ENSP00000359300	0.900	Centrin-2
20	9606.ENSP00000367527	0.900	Protein artemis

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003697	1.000	single-stranded DNA binding
GO:0016887	1.000	ATP hydrolysis activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000724	0.995	double-strand break repair via homologous recombination
GO:0050821	0.987	protein stabilization
GO:0050789	0.692	regulation of biological process
GO:0050794	0.589	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.998	protein-containing complex
GO:0070013	0.978	intracellular organelle lumen
GO:0005654	0.969	nucleoplasm
GO:0005737	0.710	cytoplasm
GO:0005829	0.422	cytosol
GO:0097196	0.375	Shu complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:13065	1.000	ATP + H2O = ADP + H(+) + phosphate

[back to server]