StarFunc result for job id Q6NVY1

User Input

>input (386 residues)
MGQREMWRLMSRFNAFKRTNTILHHLRMSKHTDAAEEVLLEKKGCTGVITLNRPKFLNAL
TLNMIRQIYPQLKKWEQDPETFLIIIKGAGGKAFCAGGDIRVISEAEKAKQKIAPVFFRE
EYMLNNAVGSCQKPYVALIHGITMGGGVGLSVHGQFRVATEKCLFAMPETAIGLFPDVGG
GYFLPRLQGKLGYFLALTGFRLKGRDVYRAGIATHFVDSEKLAMLEEDLLALKSPSKENI
ASVLENYHTESKIDRDKSFILEEHMDKINSCFSANTVEEIIENLQQDGSSFALEQLKVIN
KMSPTSLKITLRQLMEGSSKTLQEVLTMEYRLSQACMRGHDFHEGVRAVLIDKDQSPKWK
PADLKEVTEEDLNNHFKSLGSSDLKF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A140VJL0	0.933	0.933	7.624E-69	386	1.000	1.000	A0A140VJL0.pdb.gz	A0A140VJL0_HUMAN 3-hydroxyisobutyryl-CoA hydrolase OS=Homo sapiens OX=9606 PE=2 SV=1
2	PDB:3bptA	0.917	0.977	9.526E-61	362	0.917	0.978	3bptA.pdb.gz	Crystal structure of human beta-hydroxyisobutyryl-CoA hydrolase in complex with quercetin.
3	AFDB:Q8QZS1	0.919	0.921	1.623E-57	385	0.819	0.821	Q8QZS1.pdb.gz	HIBCH_MOUSE 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Mus musculus OX=10090 GN=Hibch PE=1 SV=1
4	AFDB:Q86BP1	0.862	0.862	7.069E-41	386	0.482	0.482	Q86BP1.pdb.gz	Q86BP1_DROME 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Hibch PE=1 SV=1
5	AFDB:Q9LKJ1	0.866	0.884	1.446E-35	378	0.373	0.381	Q9LKJ1.pdb.gz	HIBC1_ARATH 3-hydroxyisobutyryl-CoA hydrolase 1 OS=Arabidopsis thaliana OX=3702 GN=CHY1 PE=1 SV=1
6	AFDB:Q9SHJ8	0.866	0.864	3.199E-34	387	0.360	0.359	Q9SHJ8.pdb.gz	HIBC8_ARATH 3-hydroxyisobutyryl-CoA hydrolase-like protein 5 OS=Arabidopsis thaliana OX=3702 GN=At1g06550 PE=1 SV=2
7	AFDB:Q381D8	0.841	0.896	7.029E-34	362	0.360	0.384	Q381D8.pdb.gz	Q381D8_TRYB2 Enoyl-CoA hydratase/isomerase family protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.8200 PE=4 SV=1
8	AFDB:B8ZZZ0	0.493	0.695	2.610E-33	273	0.536	0.758	B8ZZZ0.pdb.gz	B8ZZZ0_HUMAN 3-hydroxyisobutyryl-CoA hydrolase (Fragment) OS=Homo sapiens OX=9606 GN=HIBCH PE=1 SV=1
9	AFDB:O53419	0.853	0.952	2.751E-33	345	0.339	0.380	O53419.pdb.gz	O53419_MYCTU Possible enoyl-CoA hydratase EchA9 (Enoyl hydrase) (Unsaturated acyl-CoA hydratase) (Crotonase) OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=echA9 PE=1 SV=1
10	AFDB:Q8RXN4	0.869	0.822	1.135E-32	409	0.334	0.315	Q8RXN4.pdb.gz	HIBC5_ARATH Small ribosomal subunit protein mS47 OS=Arabidopsis thaliana OX=3702 GN=At4g31810 PE=1 SV=1
11	AFDB:O74802	0.855	0.771	2.021E-32	429	0.334	0.301	O74802.pdb.gz	HIBCH_SCHPO Small ribosomal subunit protein mS47 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=snr1 PE=1 SV=1
12	PDB:6xywBE	0.824	0.910	6.800E-25	348	0.329	0.365	6xywBE.pdb.gz	Cryo-EM structure of the RNA-rich plant mitochondrial ribosome.
13	PDB:5mrc88	0.831	0.714	1.843E-24	452	0.326	0.279	5mrc88.pdb.gz	The structure of the yeast mitochondrial ribosome.
14	PDB:5zaiC	0.445	0.649	1.684E-14	259	0.210	0.313	5zaiC.pdb.gz	Structural Insight into Substrate Specificity of 3-Hydroxypropionyl-Coenzyme A Dehydratase from Metallosphaera sedula
15	PDB:2hw5C	0.426	0.619	1.971E-14	260	0.223	0.331	2hw5C.pdb.gz	The crystal structure of human enoyl-coenzyme A (CoA) hydratase short chain 1, ECHS1
16	PDB:1dubA	0.433	0.626	2.189E-14	260	0.210	0.312	1dubA.pdb.gz	Crystal structure of enoyl-coenzyme A (CoA) hydratase at 2.5 angstroms resolution: a spiral fold defines the CoA-binding pocket.
17	PDB:4fzwB	0.436	0.643	2.718E-13	256	0.166	0.250	4fzwB.pdb.gz
18	PDB:3zwaA	0.484	0.276	3.724E-13	727	0.166	0.088	3zwaA.pdb.gz	The Isomerase and Hydratase Reaction Mechanism of the Crotonase Active Site of the Multifunctional Enzyme (Type-1), as Deduced from Structures of Complexes with 3S-Hydroxy- Acyl-Coa.
19	PDB:3h81A	0.452	0.667	4.136E-13	256	0.168	0.254	3h81A.pdb.gz	Increasing the structural coverage of tuberculosis drug targets.
20	PDB:7oeqA	0.408	0.598	6.294E-13	259	0.184	0.274	7oeqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A140VJL0	0.0	803	386	1.000	1.000	A0A140VJL0_HUMAN 3-hydroxyisobutyryl-CoA hydrolase OS=Homo sapiens OX=9606 PE=2 SV=1
2	Q6NVY1	0.0	803	386	1.000	1.000	HIBCH_HUMAN 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=HIBCH PE=1 SV=2
3	Q8QZS1	0.0	673	385	0.819	0.821	HIBCH_MOUSE 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Mus musculus OX=10090 GN=Hibch PE=1 SV=1
4	B8ZZZ0	1.30e-153	436	273	0.536	0.758	B8ZZZ0_HUMAN 3-hydroxyisobutyryl-CoA hydrolase (Fragment) OS=Homo sapiens OX=9606 GN=HIBCH PE=1 SV=1
5	Q960K8	4.59e-124	365	385	0.474	0.475	Q960K8_DROME 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Hibch PE=1 SV=1
6	Q86BP1	5.06e-124	365	386	0.474	0.474	Q86BP1_DROME 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Hibch PE=1 SV=1
7	B9A058	3.14e-115	334	163	0.422	1.000	B9A058_HUMAN 3-hydroxyisobutyryl-CoA hydrolase OS=Homo sapiens OX=9606 GN=HIBCH PE=1 SV=1
8	Q9LKJ1	1.28e-92	284	378	0.378	0.386	HIBC1_ARATH 3-hydroxyisobutyryl-CoA hydrolase 1 OS=Arabidopsis thaliana OX=3702 GN=CHY1 PE=1 SV=1
9	Q9SHJ8	3.83e-79	250	387	0.370	0.370	HIBC8_ARATH 3-hydroxyisobutyryl-CoA hydrolase-like protein 5 OS=Arabidopsis thaliana OX=3702 GN=At1g06550 PE=1 SV=2
10	Q381D8	3.43e-76	241	362	0.365	0.390	Q381D8_TRYB2 Enoyl-CoA hydratase/isomerase family protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.8200 PE=4 SV=1
11	Q5AI24	1.24e-71	234	502	0.370	0.285	Q5AI24_CANAL Ehd3p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=EHD3 PE=4 SV=1
12	O53419	1.35e-69	224	345	0.339	0.380	O53419_MYCTU Possible enoyl-CoA hydratase EchA9 (Enoyl hydrase) (Unsaturated acyl-CoA hydratase) (Crotonase) OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=echA9 PE=1 SV=1
13	Q9T0K7	1.83e-69	226	421	0.376	0.344	HIBC6_ARATH 3-hydroxyisobutyryl-CoA hydrolase-like protein 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At4g13360 PE=1 SV=2
14	Q8RXN4	2.11e-67	220	409	0.339	0.320	HIBC5_ARATH Small ribosomal subunit protein mS47 OS=Arabidopsis thaliana OX=3702 GN=At4g31810 PE=1 SV=1
15	O74802	2.20e-67	221	429	0.342	0.308	HIBCH_SCHPO Small ribosomal subunit protein mS47 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=snr1 PE=1 SV=1
16	Q9LK08	4.87e-65	214	418	0.365	0.337	HIBC7_ARATH 3-hydroxyisobutyryl-CoA hydrolase-like protein 4, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At3g24360 PE=2 SV=1
17	P28817	8.75e-56	192	500	0.321	0.248	HIBCH_YEAST Small ribosomal subunit protein mS47 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EHD3 PE=1 SV=2
18	A4YI89	5.05e-25	104	259	0.181	0.270	HPCD_METS5 3-hydroxypropionyl-coenzyme A dehydratase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2) OX=399549 GN=Msed_2001 PE=1 SV=1
19	C8V3K8	6.69e-24	102	289	0.192	0.256	C8V3K8_EMENI Enoyl-CoA hydratase (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05916 PE=3 SV=1
20	Q8BH95	9.19e-23	99.0	290	0.171	0.228	ECHM_MOUSE Enoyl-CoA hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Echs1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15372 DUF4600	23	16.7	Domain of unknown function (DUF4600)
2	PF00378 ECH_1	2.8e-29	113.8	Enoyl-CoA hydratase/isomerase
3	PF16113 ECH_2	3e-132	452.8	Enoyl-CoA hydratase/isomerase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000352706

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265395	0.996	3-hydroxyisobutyrate dehydrogenase, mitochondrial
2	9606.ENSP00000312311	0.966	Mitochondrial ribosomal protein L46
3	9606.ENSP00000357535	0.959	Enoyl-CoA hydratase, mitochondrial
4	9606.ENSP00000272418	0.952	Belongs to the universal ribosomal protein uS5 family.
5	9606.ENSP00000360850	0.952	Mitochondrial ribosomal protein S2
6	9606.ENSP00000225969	0.946	Mitochondrial ribosomal protein L27
7	9606.ENSP00000264995	0.945	Mitochondrial ribosomal protein L3
8	9606.ENSP00000377486	0.945	Mitochondrial ribosomal protein L19
9	9606.ENSP00000362208	0.944	Mitochondrial ribosomal protein S15
10	9606.ENSP00000258455	0.943	Mitochondrial ribosomal protein S9
11	9606.ENSP00000357320	0.941	28S ribosomal protein S29, mitochondrial
12	9606.ENSP00000423399	0.940	Mitochondrial ribosomal protein L36
13	9606.ENSP00000288937	0.938	Mitochondrial ribosomal protein L17
14	9606.ENSP00000431040	0.938	Mitochondrial ribosomal protein L22
15	9606.ENSP00000339844	0.937	Mitochondrial ribosomal protein L43
16	9606.ENSP00000362036	0.937	Mitochondrial ribosomal protein S16
17	9606.ENSP00000417602	0.937	Belongs to the universal ribosomal protein uL29 family.
18	9606.ENSP00000306548	0.936	Mitochondrial ribosomal protein L13
19	9606.ENSP00000081029	0.932	Mitochondrial ribosomal protein S35
20	9606.ENSP00000360498	0.932	39S ribosomal protein L41, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016289	0.999	CoA hydrolase activity
GO:0005488	0.938	binding
GO:0005515	0.901	protein binding
GO:0016829	0.416	lyase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.998	cellular metabolic process
GO:0044238	0.997	primary metabolic process
GO:0071704	0.996	organic substance metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:1901564	0.990	organonitrogen compound metabolic process
GO:0046395	0.987	carboxylic acid catabolic process
GO:0009063	0.964	amino acid catabolic process
GO:0009081	0.937	branched-chain amino acid metabolic process
GO:0009083	0.862	branched-chain amino acid catabolic process
GO:0065007	0.349	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.957	intracellular organelle lumen
GO:0005759	0.899	mitochondrial matrix
GO:0032991	0.425	protein-containing complex
GO:0016020	0.345	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.2.-	0.999	Thiolester hydrolases.
EC:4.-.-.-	0.416	Lyases.

[back to server]