StarFunc result for job id Q6NXP2

User Input

>input (309 residues)
MSKIRGLPPEVREPGPGVELGVENGLLCQLIHSPEFNLFSNSVVFESNFIQTHVPEADFQ
VTKPGNWRDVCEGSATVILGVTSSVPSLPLPNVLLMANVTWPQGPFTTWSTPGDAPVINL
SRLLPLKYVELRIYDRLQRILRVRTVTEKIYYLKLHEKHPEIVFQFWVRLVKILQKGLSI
TTKDPRIKFTHCLVPKMPTNSTETTPENSLLSSPQPSEPLVLLAAEQTSGSFSQLSGKPQ
LTADRNNDTAIEIDNCSSYKIPSPVASPINLNIPMRAALSHSLWEQEDWNEHLLQVHIAS
YLGEHFLGA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6NXP2	1.000	1.000	1.318E-53	309	1.000	1.000	Q6NXP2.pdb.gz	GAR1A_HUMAN Golgi-associated RAB2 interactor protein 1A OS=Homo sapiens OX=9606 GN=GARIN1A PE=1 SV=3
2	AFDB:B2RXB0	0.550	0.572	4.581E-36	297	0.702	0.731	B2RXB0.pdb.gz	GAR1A_MOUSE Golgi-associated RAB2 interactor protein 1A OS=Mus musculus OX=10090 GN=Garin1a PE=1 SV=1
3	AFDB:Q3UZD7	0.524	0.476	2.629E-25	341	0.463	0.419	Q3UZD7.pdb.gz	GAR1B_MOUSE Golgi-associated RAB2 interactor protein 1B OS=Mus musculus OX=10090 GN=Garin1b PE=1 SV=1
4	AFDB:Q96KD3	0.498	0.451	7.234E-23	344	0.450	0.404	Q96KD3.pdb.gz	GAR1B_HUMAN Golgi-associated RAB2 interactor protein 1B OS=Homo sapiens OX=9606 GN=GARIN1B PE=1 SV=1
5	AFDB:Q8TC56	0.395	0.215	9.642E-12	605	0.236	0.121	Q8TC56.pdb.gz	GAR3_HUMAN Golgi-associated RAB2 interactor protein 3 OS=Homo sapiens OX=9606 GN=GARIN3 PE=1 SV=2
6	AFDB:A1L3C1	0.378	0.535	2.803E-11	212	0.175	0.255	A1L3C1.pdb.gz	GAR5A_MOUSE Golgi-associated RAB2 interactor protein 5A OS=Mus musculus OX=10090 GN=Garin5a PE=1 SV=2
7	AFDB:Q8NEG0	0.369	0.463	1.278E-10	241	0.178	0.228	Q8NEG0.pdb.gz	GAR6_HUMAN Golgi-associated RAB2 interactor protein 6 OS=Homo sapiens OX=9606 GN=GARIN6 PE=1 SV=1
8	AFDB:D3YV92	0.366	0.264	2.508E-9	440	0.191	0.134	D3YV92.pdb.gz	GAR2_MOUSE Golgi-associated RAB2 interactor protein 2 OS=Mus musculus OX=10090 GN=Garin2 PE=1 SV=1
9	AFDB:Q63406	0.246	0.078	1.356E-4	1149	0.091	0.024	Q63406.pdb.gz	MCF2L_RAT Guanine nucleotide exchange factor DBS OS=Rattus norvegicus OX=10116 GN=Mcf2l PE=1 SV=3
10	AFDB:Q6PDM6	0.233	0.075	4.171E-4	1166	0.123	0.033	Q6PDM6.pdb.gz	Q6PDM6_MOUSE Mcf.2 transforming sequence-like OS=Mus musculus OX=10090 GN=Mcf2l PE=1 SV=1
11	PDB:4iapA	0.181	0.213	3.176E-2	256	0.029	0.035	4iapA.pdb.gz
12	PDB:4mk0A	0.211	0.120	3.176E-2	631	0.087	0.043	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
13	PDB:2kr0A	0.202	0.161	4.707E-2	407	0.120	0.091	2kr0A.pdb.gz
14	PDB:4gouA	0.248	0.163	4.979E-2	507	0.045	0.028	4gouA.pdb.gz
15	PDB:3pvuA	0.203	0.118	5.893E-2	609	0.081	0.041	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
16	PDB:7pgrN	0.213	0.037	6.593E-2	2423	0.049	0.006	7pgrN.pdb.gz	The structure of neurofibromin isoform 2 reveals different functional states.
17	PDB:3uzsA	0.185	0.110	7.803E-2	609	0.065	0.033	3uzsA.pdb.gz	Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer.
18	PDB:4mt6A	0.203	0.165	9.236E-2	389	0.029	0.023	4mt6A.pdb.gz
19	PDB:7mp5A	0.217	0.051	1.156E-1	1629	0.029	0.006	7mp5A.pdb.gz
20	PDB:1q67B	0.206	0.344	1.369E-1	161	0.049	0.093	1q67B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6NXP2	0.0	632	309	1.000	1.000	GAR1A_HUMAN Golgi-associated RAB2 interactor protein 1A OS=Homo sapiens OX=9606 GN=GARIN1A PE=1 SV=3
2	B2RXB0	1.95e-150	425	297	0.706	0.734	GAR1A_MOUSE Golgi-associated RAB2 interactor protein 1A OS=Mus musculus OX=10090 GN=Garin1a PE=1 SV=1
3	Q96KD3	8.77e-89	270	344	0.489	0.439	GAR1B_HUMAN Golgi-associated RAB2 interactor protein 1B OS=Homo sapiens OX=9606 GN=GARIN1B PE=1 SV=1
4	Q3UZD7	2.47e-87	266	341	0.485	0.440	GAR1B_MOUSE Golgi-associated RAB2 interactor protein 1B OS=Mus musculus OX=10090 GN=Garin1b PE=1 SV=1
5	Q8TC56	2.68e-16	81.3	605	0.165	0.084	GAR3_HUMAN Golgi-associated RAB2 interactor protein 3 OS=Homo sapiens OX=9606 GN=GARIN3 PE=1 SV=2
6	Q5STT6	8.33e-14	73.9	665	0.175	0.081	GAR3_MOUSE Golgi-associated RAB2B interactor protein 3 OS=Mus musculus OX=10090 GN=Garin3 PE=1 SV=3
7	Q8NEG0	1.23e-12	68.6	241	0.152	0.195	GAR6_HUMAN Golgi-associated RAB2 interactor protein 6 OS=Homo sapiens OX=9606 GN=GARIN6 PE=1 SV=1
8	Q8IYT1	1.62e-12	70.1	594	0.149	0.077	GAR4_HUMAN Golgi-associated RAB2 interactor protein 4 OS=Homo sapiens OX=9606 GN=GARIN4 PE=1 SV=2
9	D3YV92	2.30e-09	60.1	440	0.136	0.095	GAR2_MOUSE Golgi-associated RAB2 interactor protein 2 OS=Mus musculus OX=10090 GN=Garin2 PE=1 SV=1
10	A1L3C1	0.007	39.7	212	0.149	0.217	GAR5A_MOUSE Golgi-associated RAB2 interactor protein 5A OS=Mus musculus OX=10090 GN=Garin5a PE=1 SV=2
11	A0A8I6AIS3	1.1	33.5	1564	0.146	0.029	A0A8I6AIS3_RAT Tenascin C OS=Rattus norvegicus OX=10116 GN=Tnc PE=1 SV=1
12	Q3V129	1.8	32.7	1303	0.087	0.021	ULK4_MOUSE Serine/threonine-protein kinase ULK4 OS=Mus musculus OX=10090 GN=Ulk4 PE=1 SV=2
13	E0SDC7	2.0	32.3	300	0.068	0.070	E0SDC7_DICD3 Oligogalacturonide ABC transporter, permease component OS=Dickeya dadantii (strain 3937) OX=198628 GN=togN PE=3 SV=1
14	A0A8I6AG89	4.6	31.6	2019	0.136	0.021	A0A8I6AG89_RAT Tenascin C OS=Rattus norvegicus OX=10116 GN=Tnc PE=1 SV=1
15	A0A0G2K1L0	4.7	31.6	2110	0.136	0.020	A0A0G2K1L0_RAT Tenascin C OS=Rattus norvegicus OX=10116 GN=Tnc PE=1 SV=2
16	A0A1D8PLL5	4.7	31.6	974	0.055	0.017	A0A1D8PLL5_CANAL Arg83p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ARG83 PE=4 SV=1
17	A0A8I6GHT4	4.8	31.6	1928	0.136	0.022	A0A8I6GHT4_RAT Tenascin C OS=Rattus norvegicus OX=10116 GN=Tnc PE=1 SV=1
18	A0A8I6ARC1	5.2	31.6	2202	0.136	0.019	A0A8I6ARC1_RAT Tenascin C OS=Rattus norvegicus OX=10116 GN=Tnc PE=1 SV=1
19	Q9Y5K6	7.3	30.8	639	0.061	0.030	CD2AP_HUMAN CD2-associated protein OS=Homo sapiens OX=9606 GN=CD2AP PE=1 SV=1
20	P93824	8.3	30.4	360	0.071	0.061	ACCH6_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 6 OS=Arabidopsis thaliana OX=3702 GN=At1g04350 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12480 DUF3699	5.2e-21	85.9	Protein of unknown function (DUF3699)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000420140

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000380869	0.843	Ras-related protein Rab-2B
2	9606.ENSP00000262646	0.772	Ras-related protein Rab-2A
3	9606.ENSP00000377353	0.681	D(1A) dopamine receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0022607	0.996	cellular component assembly
GO:0010256	0.995	endomembrane system organization
GO:0006996	0.995	organelle organization
GO:0010927	0.992	cellular component assembly involved in morphogenesis
GO:0022412	0.987	cellular process involved in reproduction in multicellular organism
GO:0033363	0.987	secretory granule organization
GO:0007276	0.987	gamete generation
GO:0003006	0.986	developmental process involved in reproduction
GO:0030154	0.985	cell differentiation
GO:0048468	0.984	cell development
GO:0007286	0.922	spermatid development
GO:0070925	0.737	organelle assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	0.999	Golgi apparatus
GO:0016020	0.498	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]