StarFunc result for job id Q6NXS1

User Input

>input (205 residues)
MAASTASHRPIKGILKNKTSTTSSMVASAEQPRRSVDEELSKKSQKWDEINILATYHPAD
KGYGLMKIDEPSPPYHSMMGDDEDACRDTETTEAMAPDILAKKLAAAEGLEPKYRIQEQE
SSGEEDSDLSPEEREKKRQFEMRRKLHYNEGLNIKLARQLISKDLHDDDEDEEMLETADG
ESMNTEESNQGSTPSDQQQNKLRSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P11845	0.576	0.576	5.541E-25	205	0.902	0.902	P11845.pdb.gz	IPP2_RABIT Protein phosphatase inhibitor 2 OS=Oryctolagus cuniculus OX=9986 GN=PPP1R2 PE=1 SV=3
2	AFDB:Q9DCL8	0.214	0.213	2.955E-20	206	0.824	0.820	Q9DCL8.pdb.gz	IPP2_MOUSE Protein phosphatase inhibitor 2 OS=Mus musculus OX=10090 GN=Ppp1r2 PE=1 SV=3
3	AFDB:O14990	0.426	0.432	2.620E-8	202	0.415	0.421	O14990.pdb.gz	IPP2C_HUMAN Protein phosphatase inhibitor 2 family member C OS=Homo sapiens OX=9606 GN=PPP1R2C PE=1 SV=1
4	AFDB:Q9N537	0.428	0.452	2.808E-6	193	0.273	0.290	Q9N537.pdb.gz	Q9N537_CAEEL Protein phosphatase inhibitor 2 OS=Caenorhabditis elegans OX=6239 GN=szy-2 PE=1 SV=2
5	PDB:2o8aI	0.249	0.833	7.020E-3	59	0.244	0.847	2o8aI.pdb.gz
6	AFDB:M3VX86	0.115	0.119	4.358E-1	198	0.107	0.111	M3VX86.pdb.gz	M3VX86_FELCA Corticotropin releasing hormone OS=Felis catus OX=9685 GN=CRH PE=3 SV=1
7	AFDB:Q9UTP9	0.169	0.066	7.435E-1	735	0.127	0.035	Q9UTP9.pdb.gz	DBP4_SCHPO ATP-dependent RNA helicase dbp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dbp4 PE=1 SV=1
8	AFDB:Q8NHH1	0.170	0.058	7.948E-1	800	0.141	0.036	Q8NHH1.pdb.gz	TTL11_HUMAN Tubulin polyglutamylase TTLL11 OS=Homo sapiens OX=9606 GN=TTLL11 PE=1 SV=2
9	AFDB:Q95T64	0.106	0.067	8.497E-1	368	0.078	0.043	Q95T64.pdb.gz	PGPLA_DROME Peptidoglycan-recognition protein LA OS=Drosophila melanogaster OX=7227 GN=PGRP-LA PE=1 SV=2
10	AFDB:Q54B43	0.187	0.054	9.084E-1	861	0.093	0.022	Q54B43.pdb.gz	Q54B43_DICDI Leucine-rich repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0293920 PE=4 SV=1
11	AFDB:Q4VXL8	0.193	0.053	9.711E-1	1038	0.176	0.035	Q4VXL8.pdb.gz	Q4VXL8_HUMAN Transforming acidic coiled-coil containing protein 2 OS=Homo sapiens OX=9606 GN=TACC2 PE=1 SV=1
12	PDB:7ungi	0.124	0.103	1.568	250	0.122	0.100	7ungi.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
13	PDB:7btbm	0.132	0.066	2.189	469	0.112	0.049	7btbm.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
14	PDB:7rroi	0.112	0.099	2.502	235	0.146	0.128	7rroi.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
15	PDB:7o4i1	0.118	0.053	4.879	522	0.083	0.033	7o4i1.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
16	PDB:6i9r6	0.095	0.067	6.812	354	0.059	0.034	6i9r6.pdb.gz	Inhibition of mitochondrial translation suppresses glioblastoma stem cell growth.
17	PDB:5mrcQ	0.112	0.089	7.283	284	0.117	0.085	5mrcQ.pdb.gz	The structure of the yeast mitochondrial ribosome.
18	PDB:7wtxt	0.093	0.138	7.786	132	0.112	0.174	7wtxt.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
19	PDB:7z8fj	0.074	0.050	8.323	330	0.044	0.027	7z8fj.pdb.gz	Structure of dynein-dynactin on microtubules shows tandem adaptor binding.
20	PDB:6v8oO	0.099	0.057	9.512	384	0.146	0.078	6v8oO.pdb.gz	Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6NXS1	2.04e-151	419	205	1.000	1.000	IPP2B_HUMAN Protein phosphatase inhibitor 2 family member B OS=Homo sapiens OX=9606 GN=PPP1R2B PE=1 SV=2
2	P41236	1.14e-137	385	205	0.956	0.956	IPP2_HUMAN Protein phosphatase inhibitor 2 OS=Homo sapiens OX=9606 GN=PPP1R2 PE=1 SV=2
3	P11845	1.16e-127	360	205	0.902	0.902	IPP2_RABIT Protein phosphatase inhibitor 2 OS=Oryctolagus cuniculus OX=9986 GN=PPP1R2 PE=1 SV=3
4	P50411	3.26e-118	336	205	0.834	0.834	IPP2_RAT Protein phosphatase inhibitor 2 OS=Rattus norvegicus OX=10116 GN=Ppp1r2 PE=1 SV=2
5	Q9DCL8	4.62e-112	320	206	0.824	0.820	IPP2_MOUSE Protein phosphatase inhibitor 2 OS=Mus musculus OX=10090 GN=Ppp1r2 PE=1 SV=3
6	O14990	7.95e-40	137	202	0.420	0.426	IPP2C_HUMAN Protein phosphatase inhibitor 2 family member C OS=Homo sapiens OX=9606 GN=PPP1R2C PE=1 SV=1
7	Q9V3C7	6.48e-19	82.8	205	0.317	0.317	Q9V3C7_DROME Inhibitor-2 OS=Drosophila melanogaster OX=7227 GN=I-2 PE=1 SV=1
8	Q9N537	1.01e-18	82.0	193	0.298	0.316	Q9N537_CAEEL Protein phosphatase inhibitor 2 OS=Caenorhabditis elegans OX=6239 GN=szy-2 PE=1 SV=2
9	A8JNP7	6.05e-18	82.0	310	0.322	0.213	A8JNP7_DROME Inhibitor-2, isoform B OS=Drosophila melanogaster OX=7227 GN=I-2 PE=1 SV=1
10	C0H480	0.018	36.6	144	0.176	0.250	C0H480_PLAF7 Protein phosphatase inhibitor 2 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0320000 PE=1 SV=1
11	E9PFK5	1.0	32.7	788	0.146	0.038	E9PFK5_HUMAN NOP14 nucleolar protein OS=Homo sapiens OX=9606 GN=NOP14 PE=1 SV=1
12	P78316	1.2	32.3	857	0.146	0.035	NOP14_HUMAN Nucleolar protein 14 OS=Homo sapiens OX=9606 GN=NOP14 PE=1 SV=3
13	A0A8I6GFN0	3.0	31.2	2477	0.083	0.007	A0A8I6GFN0_RAT non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Lrrk2 PE=4 SV=1
14	F1LNJ1	3.1	31.2	2526	0.083	0.007	F1LNJ1_RAT non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Lrrk2 PE=1 SV=3
15	Q5S006	3.3	31.2	2527	0.083	0.007	LRRK2_MOUSE Leucine-rich repeat serine/threonine-protein kinase 2 OS=Mus musculus OX=10090 GN=Lrrk2 PE=1 SV=2
16	Q17RV3	3.9	30.8	2527	0.083	0.007	Q17RV3_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=LRRK2 PE=2 SV=1
17	Q5S007	4.1	30.8	2527	0.083	0.007	LRRK2_HUMAN Leucine-rich repeat serine/threonine-protein kinase 2 OS=Homo sapiens OX=9606 GN=LRRK2 PE=1 SV=2
18	P41818	4.7	30.0	229	0.176	0.157	GLC8_YEAST Protein GLC8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GLC8 PE=1 SV=1
19	Q14210	7.4	28.9	128	0.073	0.117	LY6D_HUMAN Lymphocyte antigen 6D OS=Homo sapiens OX=9606 GN=LY6D PE=1 SV=1
20	O27552	9.7	29.6	937	0.137	0.030	SYL_METTH Leucine--tRNA ligase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) OX=187420 GN=leuS PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04979 IPP-2	3.1e-33	126.7	Protein phosphatase inhibitor 2 (IPP-2)
2	PF19112 VanA_C	21	16.7	Vanillate O-demethylase oxygenase C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000027114

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000030557	0.916	Protein phosphatase 1 regulatory subunit 11
2	9598.ENSPTRP00000022464	0.873	Protein phosphatase 1, regulatory (Inhibitor) subunit 7
3	9598.ENSPTRP00000009252	0.871	Belongs to the PPP phosphatase family.
4	9598.ENSPTRP00000009251	0.861	Protein phosphatase 1, catalytic subunit, alpha isozyme
5	9598.ENSPTRP00000020246	0.809	Belongs to the PPP phosphatase family.
6	9598.ENSPTRP00000023550	0.761	Protein phosphatase 1, regulatory subunit 3D
7	9598.ENSPTRP00000034207	0.761	Protein phosphatase 1 regulatory subunit 3
8	9598.ENSPTRP00000029821	0.736	Uncharacterized protein
9	9598.ENSPTRP00000008585	0.668	Protein phosphatase 1, regulatory (inhibitor) subunit 1A
10	9598.ENSPTRP00000060374	0.663	Sarcoglycan, delta (35kDa dystrophin-associated glycoprotein)
11	9598.ENSPTRP00000026315	0.654	Glycogen synthase kinase 3 beta
12	9598.ENSPTRP00000060689	0.607	Protein phosphatase 1 regulatory subunit 3
13	9598.ENSPTRP00000049087	0.598	Thioredoxin domain containing 8 (spermatozoa)
14	9598.ENSPTRP00000000731	0.591	Protein phosphatase 1, regulatory (Inhibitor) subunit 8
15	9598.ENSPTRP00000030588	0.569	Serine/threonine-protein phosphatase 1 regulatory subunit 10
16	9598.ENSPTRP00000021106	0.534	Uncharacterized protein
17	9598.ENSPTRP00000047442	0.513	Calcium/calmodulin-dependent serine protein kinase (MAGUK family)
18	9598.ENSPTRP00000053618	0.501	Serine/threonine-protein phosphatase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004864	0.998	protein phosphatase inhibitor activity
GO:0008157	0.979	protein phosphatase 1 binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065009	0.970	regulation of molecular function
GO:0051098	0.856	regulation of binding
GO:0043393	0.854	regulation of protein binding
GO:0044237	0.847	cellular metabolic process
GO:0035304	0.837	regulation of protein dephosphorylation
GO:0006091	0.782	generation of precursor metabolites and energy
GO:0045936	0.740	negative regulation of phosphate metabolic process
GO:0031400	0.652	negative regulation of protein modification process
GO:0044092	0.345	negative regulation of molecular function

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0032991	0.995	protein-containing complex
GO:0043232	0.995	intracellular non-membrane-bounded organelle
GO:0008287	0.972	protein serine/threonine phosphatase complex
GO:0120025	0.965	plasma membrane bounded cell projection
GO:0045202	0.965	synapse
GO:0030425	0.961	dendrite
GO:0000164	0.961	protein phosphatase type 1 complex
GO:0098794	0.914	postsynapse
GO:0043231	0.834	intracellular membrane-bounded organelle
GO:0005634	0.816	nucleus
GO:0099080	0.797	supramolecular complex
GO:0016020	0.736	membrane
GO:0098978	0.651	glutamatergic synapse
GO:0030424	0.604	axon
GO:0044309	0.551	neuron spine
GO:0043197	0.501	dendritic spine
GO:0030427	0.455	site of polarized growth
GO:0099512	0.385	supramolecular fiber
GO:0098723	0.367	skeletal muscle myofibril
GO:0043025	0.340	neuronal cell body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]