StarFunc result for job id Q6NXT1

User Input

>input (300 residues)
MAAAAGDADDEPRSGHSSSEGECAVAPEPLTDAEGLFSFADFGSALGGGGAGLSGRASGG
AQSPLRYLHVLWQQDAEPRDELRCKIPAGRLRRAARPHRRLGPTGKEVHALKRLRDSANA
NDVETVQQLLEDGADPCAADDKGRTALHFASCNGNDQIVQLLLDHGADPNQRDGLGNTPL
HLAACTNHVPVITTLLRGGARVDALDRAGRTPLHLAKSKLNILQEGHAQCLEAVRLEVKQ
IIHMLREYLERLGQHEQRERLDDLCTRLQMTSTKEQVDEVTDLLASFTSLSLQMQSMEKR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6NXT1	1.000	1.000	1.291E-39	300	1.000	1.000	Q6NXT1.pdb.gz	ANR54_HUMAN Ankyrin repeat domain-containing protein 54 OS=Homo sapiens OX=9606 GN=ANKRD54 PE=1 SV=2
2	AFDB:Q3KN55	0.364	0.164	6.797E-9	697	0.197	0.085	Q3KN55.pdb.gz	Q3KN55_DROME Ankyrin 2, isoform E OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
3	AFDB:O22265	0.432	0.351	2.502E-8	373	0.177	0.142	O22265.pdb.gz	SR43C_ARATH Signal recognition particle 43 kDa protein, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CAO PE=1 SV=2
4	AFDB:A0A024R7P0	0.375	0.463	2.876E-8	237	0.187	0.236	A0A024R7P0.pdb.gz	A0A024R7P0_HUMAN Regulatory factor X associated ankyrin containing protein OS=Homo sapiens OX=9606 GN=RFXANK PE=1 SV=1
5	AFDB:B3CTB0	0.393	0.354	4.799E-8	336	0.170	0.152	B3CTB0.pdb.gz	B3CTB0_ORITI Ankyrin repeat-containing protein 06_02 OS=Orientia tsutsugamushi (strain Ikeda) OX=334380 GN=OTT_1149 PE=1 SV=1
6	AFDB:Q9H765	0.354	0.367	5.028E-8	288	0.190	0.198	Q9H765.pdb.gz	ASB8_HUMAN Ankyrin repeat and SOCS box protein 8 OS=Homo sapiens OX=9606 GN=ASB8 PE=1 SV=1
7	AFDB:A1DRY3	0.347	0.142	6.648E-8	782	0.217	0.083	A1DRY3.pdb.gz	A1DRY3_HUMAN Several ankyrin repeat protein transcript variant 2 (Fragment) OS=Homo sapiens OX=9606 PE=1 SV=1
8	AFDB:Q29Q26	0.373	0.327	7.296E-8	344	0.160	0.140	Q29Q26.pdb.gz	AKR2B_ARATH Ankyrin repeat domain-containing protein 2B OS=Arabidopsis thaliana OX=3702 GN=AKR2B PE=1 SV=1
9	AFDB:F4JN13	0.349	0.300	8.008E-8	350	0.147	0.126	F4JN13.pdb.gz	F4JN13_ARATH Ankyrin repeat-containing protein 2 OS=Arabidopsis thaliana OX=3702 GN=AKR2 PE=1 SV=1
10	AFDB:Q54KA7	0.391	0.127	9.646E-8	986	0.160	0.049	Q54KA7.pdb.gz	SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum OX=44689 GN=secG PE=2 SV=1
11	PDB:8cs9A	0.355	0.139	1.981E-7	796	0.150	0.057	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
12	PDB:2dvwA	0.367	0.475	8.385E-7	229	0.157	0.205	2dvwA.pdb.gz
13	PDB:4oauC	0.334	0.159	2.127E-6	692	0.183	0.079	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
14	PDB:6jd6B	0.392	0.599	2.127E-6	192	0.123	0.193	6jd6B.pdb.gz
15	PDB:6mwqA	0.354	0.217	2.127E-6	493	0.170	0.103	6mwqA.pdb.gz
16	PDB:1bd8A	0.333	0.603	3.086E-6	156	0.143	0.276	1bd8A.pdb.gz
17	PDB:3ehqA	0.329	0.536	4.275E-6	182	0.093	0.154	3ehqA.pdb.gz
18	PDB:5vkqA	0.350	0.081	8.201E-6	1499	0.157	0.031	5vkqA.pdb.gz
19	PDB:1bu9A	0.346	0.594	1.727E-5	168	0.140	0.250	1bu9A.pdb.gz
20	PDB:6pqpA	0.331	0.167	1.986E-5	615	0.137	0.067	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6NXT1	0.0	607	300	1.000	1.000	ANR54_HUMAN Ankyrin repeat domain-containing protein 54 OS=Homo sapiens OX=9606 GN=ANKRD54 PE=1 SV=2
2	Q91WK7	0.0	532	299	0.920	0.923	ANR54_MOUSE Ankyrin repeat domain-containing protein 54 OS=Mus musculus OX=10090 GN=Ankrd54 PE=1 SV=1
3	Q8GZ22	1.17e-17	82.4	240	0.150	0.188	Q8GZ22_ARATH Ankyrin repeat family protein OS=Arabidopsis thaliana OX=3702 GN=At2g03430 PE=1 SV=1
4	Q9H765	4.34e-17	81.6	288	0.160	0.167	ASB8_HUMAN Ankyrin repeat and SOCS box protein 8 OS=Homo sapiens OX=9606 GN=ASB8 PE=1 SV=1
5	Q9ULJ7	2.50e-16	81.6	1429	0.173	0.036	ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens OX=9606 GN=ANKRD50 PE=1 SV=4
6	Q86SG2	3.86e-16	79.3	305	0.180	0.177	ANR23_HUMAN Ankyrin repeat domain-containing protein 23 OS=Homo sapiens OX=9606 GN=ANKRD23 PE=1 SV=1
7	Q1LXN7	1.27e-15	79.3	1060	0.153	0.043	Q1LXN7_DANRE Tumor protein p53 binding protein, 2 OS=Danio rerio OX=7955 GN=si:dkeyp-34c12.2 PE=4 SV=1
8	F1QWN1	1.30e-15	79.3	1063	0.153	0.043	F1QWN1_DANRE Tumor protein p53 binding protein, 2 isoform X1 OS=Danio rerio OX=7955 GN=si:dkeyp-34c12.2 PE=4 SV=2
9	A0A8I6B0D0	2.28e-15	77.0	306	0.167	0.163	A0A8I6B0D0_RAT Ankyrin repeat domain 23 OS=Rattus norvegicus OX=10116 GN=Ankrd23 PE=4 SV=1
10	D3ZVB9	2.29e-15	77.0	298	0.167	0.168	D3ZVB9_RAT Ankyrin repeat domain 23 OS=Rattus norvegicus OX=10116 GN=Ankrd23 PE=4 SV=3
11	Q812A3	3.23e-15	76.6	306	0.170	0.167	ANR23_MOUSE Ankyrin repeat domain-containing protein 23 OS=Mus musculus OX=10090 GN=Ankrd23 PE=2 SV=1
12	Q6NSN9	5.76e-15	77.4	1060	0.147	0.042	Q6NSN9_DANRE Apoptosis-stimulating of p53 protein 2 OS=Danio rerio OX=7955 GN=tp53bp2 PE=1 SV=1
13	F1R419	5.81e-15	77.4	1060	0.147	0.042	F1R419_DANRE Apoptosis-stimulating of p53 protein 2 isoform X1 OS=Danio rerio OX=7955 GN=tp53bp2 PE=1 SV=1
14	Q5GIG6	7.65e-15	77.0	834	0.173	0.062	TNI3K_MOUSE Serine/threonine-protein kinase TNNI3K OS=Mus musculus OX=10090 GN=Tnni3k PE=2 SV=4
15	X2JC49	8.16e-15	77.4	4233	0.157	0.011	X2JC49_DROME Ankyrin 2, isoform Z OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
16	A8JNM5	8.40e-15	77.4	4264	0.157	0.011	A8JNM5_DROME Ankyrin 2, isoform K OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
17	A0A8I6AMB5	8.56e-15	77.0	1146	0.163	0.043	A0A8I6AMB5_RAT Tumor protein p53 binding protein, 2 OS=Rattus norvegicus OX=10116 GN=Tp53bp2 PE=1 SV=1
18	M9PEN3	8.64e-15	77.4	4373	0.157	0.011	M9PEN3_DROME Ankyrin 2, isoform V OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
19	A8JNM4	8.89e-15	77.0	2532	0.157	0.019	A8JNM4_DROME Ankyrin 2, isoform G OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
20	Q7KU95	9.02e-15	77.0	2404	0.157	0.020	Q7KU95_DROME Ankyrin 2, isoform M OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	7.5e-20	81.7	Ankyrin repeat
2	PF12796 Ank_2	5.5e-16	70.2	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	7.7e-12	55.2	Ankyrin repeat
4	PF13637 Ank_4	1e-15	69.1	Ankyrin repeats (many copies)
5	PF13857 Ank_5	5.4e-11	53.8	Ankyrin repeats (many copies)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000215941

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261434	0.908	Lipoyl synthase, mitochondrial
2	9606.ENSP00000380321	0.739	Tubby-related protein 3
3	9606.ENSP00000419740	0.739	5-methylcytosine rRNA methyltransferase NSUN4
4	9606.ENSP00000480378	0.734	Transcription termination factor 4, mitochondrial
5	9606.ENSP00000392828	0.724	G-protein-signaling modulator 1
6	9606.ENSP00000428924	0.696	Tyrosine-protein kinase Lyn
7	9606.ENSP00000304501	0.619	Adenosine receptor A2b
8	9606.ENSP00000483570	0.608	Tyrosine-protein kinase BTK
9	9606.ENSP00000348471	0.565	SH3 domain-containing YSC84-like protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0009987	0.988	cellular process
GO:0048583	0.911	regulation of response to stimulus
GO:0048518	0.847	positive regulation of biological process
GO:0019222	0.822	regulation of metabolic process
GO:0051239	0.821	regulation of multicellular organismal process
GO:0002682	0.798	regulation of immune system process
GO:1903706	0.784	regulation of hemopoiesis
GO:0060255	0.772	regulation of macromolecule metabolic process
GO:0048522	0.759	positive regulation of cellular process
GO:0080090	0.758	regulation of primary metabolic process
GO:0051171	0.758	regulation of nitrogen compound metabolic process
GO:0031323	0.756	regulation of cellular metabolic process
GO:0009966	0.718	regulation of signal transduction
GO:0065009	0.704	regulation of molecular function
GO:0045637	0.687	regulation of myeloid cell differentiation
GO:0045646	0.678	regulation of erythrocyte differentiation
GO:0051179	0.480	localization
GO:0048519	0.451	negative regulation of biological process
GO:0050896	0.438	response to stimulus
GO:0048523	0.429	negative regulation of cellular process
GO:0051234	0.403	establishment of localization
GO:0051128	0.367	regulation of cellular component organization
GO:0009893	0.335	positive regulation of metabolic process
GO:0051641	0.312	cellular localization
GO:0071704	0.306	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005634	0.986	nucleus
GO:0005829	0.837	cytosol
GO:0030496	0.631	midbody
GO:0016020	0.332	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]