StarFunc result for job id Q6NXT2

User Input

>input (135 residues)
MARTKQTARKSTGGKAPRKQLATKAARKSTPSTCGVKPHRYRPGTVALREIRRYQKSTEL
LIRKLPFQRLVREIAQDFNTDLRFQSAAVGALQEASEAYLVGLLEDTNLCAIHAKRVTIM
PKDIQLARRIRGERA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A8MRL0	0.845	0.704	5.877E-19	164	0.933	0.768	A8MRL0.pdb.gz	A8MRL0_ARATH Histone superfamily protein OS=Arabidopsis thaliana OX=3702 GN=H33 PE=3 SV=1
2	AFDB:P07041	0.942	0.935	1.966E-18	136	0.874	0.868	P07041.pdb.gz	H3_NEUCR Histone H3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=hh3 PE=1 SV=3
3	AFDB:O15819	0.965	0.938	5.751E-18	139	0.844	0.820	O15819.pdb.gz	H33A_DICDI Histone H3.3 type a OS=Dictyostelium discoideum OX=44689 GN=H3a PE=1 SV=1
4	AFDB:Q55BN9	0.948	0.942	5.751E-18	136	0.837	0.831	Q55BN9.pdb.gz	H33B_DICDI Histone H3.3 type b OS=Dictyostelium discoideum OX=44689 GN=H3b PE=1 SV=1
5	PDB:1kx5A	0.784	0.784	7.820E-16	135	0.933	0.933	1kx5A.pdb.gz	Solvent Mediated Interactions in the Structure of the Nucleosome Core Particle at 1.9 A Resolution
6	AFDB:P0DPK5	0.730	0.673	1.007E-15	147	0.778	0.714	P0DPK5.pdb.gz	H3Y2_HUMAN Histone H3.X OS=Homo sapiens OX=9606 GN=H3Y2 PE=5 SV=1
7	PDB:4jjnA	0.721	0.990	8.963E-13	98	0.615	0.847	4jjnA.pdb.gz	Heterochromatin protein Sir3 induces contacts between the amino terminus of histone H4 and nucleosomal DNA.
8	PDB:5ay8A	0.712	0.988	8.963E-13	97	0.585	0.814	5ay8A.pdb.gz	Structure and function of human histone H3.Y nucleosome
9	AFDB:Q4GYX7	0.800	0.812	2.258E-12	133	0.526	0.534	Q4GYX7.pdb.gz	Q4GYX7_TRYB2 Histone H3, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.2430 PE=1 SV=1
10	AFDB:Q9Y812	0.685	0.768	4.417E-12	120	0.533	0.600	Q9Y812.pdb.gz	CENPA_SCHPO Histone H3-like centromeric protein cnp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cnp1 PE=1 SV=1
11	AFDB:Q387X7	0.731	0.711	4.724E-12	139	0.430	0.417	Q387X7.pdb.gz	Q387X7_TRYB2 Histone H3 variant OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.1090 PE=3 SV=1
12	AFDB:Q8IDZ1	0.732	0.584	7.065E-12	170	0.474	0.376	Q8IDZ1.pdb.gz	Q8IDZ1_PLAF7 Histone H3-like centromeric protein CSE4 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1333700 PE=3 SV=1
13	AFDB:Q59LN9	0.722	0.468	9.240E-12	211	0.593	0.379	Q59LN9.pdb.gz	CENPA_CANAL Histone H3-like centromeric protein CSE4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CSE4 PE=3 SV=1
14	PDB:7on1e	0.665	0.914	1.175E-9	97	0.474	0.660	7on1e.pdb.gz	Cenp-A nucleosome in complex with Cenp-C
15	PDB:4h9sA	0.498	0.731	1.757E-9	89	0.578	0.876	4h9sA.pdb.gz
16	PDB:7xayD	0.541	0.743	2.298E-9	97	0.607	0.845	7xayD.pdb.gz	Topography of histone H3-H4 interaction with the Hat1-Hat2 acetyltransferase complex.
17	PDB:6e0cA	0.644	0.873	9.199E-8	99	0.415	0.566	6e0cA.pdb.gz	Atomic resolution cryo-EM structure of a native-like CENP-A nucleosome aided by an antibody fragment.
18	PDB:6xwtA	0.481	0.843	6.451E-4	74	0.222	0.405	6xwtA.pdb.gz
19	PDB:3vh5A	0.453	0.592	2.308E-3	100	0.148	0.200	3vh5A.pdb.gz
20	PDB:5y27A	0.455	0.613	3.452E-3	98	0.096	0.133	5y27A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6NXT2	6.14e-96	273	135	1.000	1.000	H3C_HUMAN Histone H3.3C OS=Homo sapiens OX=9606 GN=H3-5 PE=1 SV=3
2	C0HL66	8.57e-90	258	136	0.963	0.956	H33A_DROME Histone H3.3A OS=Drosophila melanogaster OX=7227 GN=His3.3A PE=1 SV=1
3	C0HL67	8.57e-90	258	136	0.963	0.956	H33B_DROME Histone H3.3B OS=Drosophila melanogaster OX=7227 GN=His3.3B PE=1 SV=1
4	C1BEZ2	8.57e-90	258	136	0.963	0.956	C1BEZ2_ONCMY Histone H3 OS=Oncorhynchus mykiss OX=8022 GN=H33 PE=2 SV=1
5	P84243	8.57e-90	258	136	0.963	0.956	H33_HUMAN Histone H3.3 OS=Homo sapiens OX=9606 GN=H3-3A PE=1 SV=2
6	P84244	8.57e-90	258	136	0.963	0.956	H33_MOUSE Histone H3.3 OS=Mus musculus OX=10090 GN=H3-3a PE=1 SV=2
7	P84245	8.57e-90	258	136	0.963	0.956	H33_RAT Histone H3.3 OS=Rattus norvegicus OX=10116 GN=H3-3b PE=1 SV=2
8	C1BF09	1.26e-89	258	136	0.956	0.949	C1BF09_ONCMY Histone H3 OS=Oncorhynchus mykiss OX=8022 GN=H33 PE=2 SV=1
9	C1BGV2	2.15e-89	257	136	0.956	0.949	C1BGV2_ONCMY Histone H3 OS=Oncorhynchus mykiss OX=8022 GN=H33 PE=2 SV=1
10	C1BG88	4.69e-89	256	136	0.956	0.949	C1BG88_ONCMY Histone H3 OS=Oncorhynchus mykiss OX=8022 GN=H33 PE=2 SV=1
11	C1BGA8	5.35e-89	256	136	0.956	0.949	C1BGA8_ONCMY Histone H3 OS=Oncorhynchus mykiss OX=8022 GN=H33 PE=2 SV=1
12	Q9U281	6.24e-89	256	136	0.948	0.941	H332_CAEEL Histone H3.3 type 2 OS=Caenorhabditis elegans OX=6239 GN=his-72 PE=1 SV=3
13	P02299	7.22e-88	253	136	0.948	0.941	H3_DROME Histone H3 OS=Drosophila melanogaster OX=7227 GN=His3 PE=1 SV=4
14	P84228	7.22e-88	253	136	0.948	0.941	H32_MOUSE Histone H3.2 OS=Mus musculus OX=10090 GN=H3c2 PE=1 SV=2
15	P84233	7.22e-88	253	136	0.948	0.941	H32_XENLA Histone H3.2 OS=Xenopus laevis OX=8355 PE=1 SV=2
16	Q71DI3	7.22e-88	253	136	0.948	0.941	H32_HUMAN Histone H3.2 OS=Homo sapiens OX=9606 GN=H3C15 PE=1 SV=3
17	P59226	9.10e-87	250	136	0.926	0.919	H31_ARATH Histone H3.1 OS=Arabidopsis thaliana OX=3702 GN=HTR2 PE=1 SV=2
18	P68431	1.20e-86	250	136	0.941	0.934	H31_HUMAN Histone H3.1 OS=Homo sapiens OX=9606 GN=H3C1 PE=1 SV=2
19	P68432	1.20e-86	250	136	0.941	0.934	H31_BOVIN Histone H3.1 OS=Bos taurus OX=9913 PE=1 SV=2
20	P68433	1.20e-86	250	136	0.941	0.934	H31_MOUSE Histone H3.1 OS=Mus musculus OX=10090 GN=H3c1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00808 CBFD_NFYB_HMF	8.4	18.1	Histone-like transcription factor (CBF/NF-Y) and archaeal histone
2	PF15630 CENP-S	1.5	20.6	CENP-S protein
3	PF15511 CENP-T_C	0.079	24.4	Centromere kinetochore component CENP-T histone fold
4	PF00125 Histone	1.1e-46	169.6	Core histone H2A/H2B/H3/H4
5	PF15715 PAF	2.1	20.5	PCNA-associated factor histone like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000339835

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000244537	0.978	Histone cluster 1 H4 family member f
2	9606.ENSP00000307208	0.934	Nucleosome-remodeling factor subunit BPTF
3	9606.ENSP00000333277	0.902	Histone cluster 2 H3 family member d
4	9606.ENSP00000358154	0.902	Histone cluster 2 H3 family member c
5	9606.ENSP00000385479	0.902	Histone H3.2
6	9606.ENSP00000476960	0.902	Histone cluster 2 H3 pseudogene 2
7	9606.ENSP00000303373	0.901	Histone cluster 1 H2A family member e
8	9606.ENSP00000264108	0.899	Histone acetyltransferase type B catalytic subunit
9	9606.ENSP00000347168	0.898	Histone cluster 1 H4 family member j
10	9606.ENSP00000366956	0.898	Histone cluster 1 H4 family member h
11	9606.ENSP00000366974	0.898	Histone cluster 1 H4 family member b
12	9606.ENSP00000367034	0.898	Histone cluster 1 H4 family member c
13	9606.ENSP00000443017	0.898	Histone cluster 4, H4
14	9606.ENSP00000462355	0.898	Histone cluster 2 H4 family member b
15	9606.ENSP00000462667	0.898	Histone cluster 2 H4 family member a
16	9606.ENSP00000479106	0.898	Histone cluster 1 H4 family member a
17	9606.ENSP00000479461	0.898	Histone cluster 1 H4 family member d
18	9606.ENSP00000479794	0.898	Histone cluster 1 H4 family member k
19	9606.ENSP00000480960	0.898	Histone cluster 1 H4 family member l
20	9606.ENSP00000481486	0.898	Histone cluster 1 H4 family member i

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.492	organic cyclic compound binding
GO:1901363	0.491	heterocyclic compound binding
GO:0003677	0.483	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.986	biological regulation
GO:0071840	0.985	cellular component organization or biogenesis
GO:0050789	0.983	regulation of biological process
GO:0016043	0.983	cellular component organization
GO:0006338	0.957	chromatin remodeling
GO:0019222	0.917	regulation of metabolic process
GO:0050794	0.895	regulation of cellular process
GO:0060255	0.852	regulation of macromolecule metabolic process
GO:0065004	0.838	protein-DNA complex assembly
GO:0010468	0.834	regulation of gene expression
GO:0048519	0.567	negative regulation of biological process
GO:0048518	0.472	positive regulation of biological process
GO:0048522	0.454	positive regulation of cellular process
GO:0034728	0.453	nucleosome organization
GO:0031323	0.437	regulation of cellular metabolic process
GO:0080090	0.428	regulation of primary metabolic process
GO:0051171	0.428	regulation of nitrogen compound metabolic process
GO:0048523	0.397	negative regulation of cellular process
GO:0019219	0.397	regulation of nucleobase-containing compound metabolic process
GO:0050896	0.390	response to stimulus
GO:0008152	0.379	metabolic process
GO:0010605	0.376	negative regulation of macromolecule metabolic process
GO:0009889	0.368	regulation of biosynthetic process
GO:0071704	0.367	organic substance metabolic process
GO:2001141	0.364	regulation of RNA biosynthetic process
GO:0006355	0.352	regulation of DNA-templated transcription
GO:0043170	0.312	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000785	0.996	chromatin
GO:0005654	0.996	nucleoplasm
GO:0032991	0.989	protein-containing complex
GO:0044815	0.525	DNA packaging complex
GO:0000786	0.524	nucleosome
GO:0140513	0.402	nuclear protein-containing complex
GO:0005576	0.368	extracellular region
GO:0098687	0.352	chromosomal region
GO:0005737	0.305	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]