StarFunc result for job id Q6NXT6

User Input

>input (567 residues)
MAGVGDAAAPGEGGGGGVDGPQRDGRGEAEQPGGSGGQGPPPAPQLTETLGFYESDRRRE
RRRGRTELSLLRFLSAELTRGYFLEHNEAKYTERRERVYTCLRIPRELEKLMVFGIFLCL
DAFLYVFTLLPLRVFLALFRLLTLPCYGLRDRRLLQPAQVCDILKGVILVICYFMMHYVD
YSMMYHLIRGQSVIKLYIIYNMLEVADRLFSSFGQDILDALYWTATEPKERKRAHIGVIP
HFFMAVLYVFLHAILIMVQATTLNVAFNSHNKSLLTIMMSNNFVEIKGSVFKKFEKNNLF
QMSNSDIKERFTNYVLLLIVCLRNMEQFSWNPDHLWVLFPDVCMVIASEIAVDIVKHAFI
TKFNDITADVYSEYRASLAFDLVSSRQKNAYTDYSDSVARRMGFIPLPLAVLLIRVVTSS
IKVQGILSYACVILFYFGLISLKVLNSIVLLGKSCQYVKEAKMEEKLSNPPATCTPGKPS
SKSQNKCKPSQGLSTEENLSASITKQPIHQKENIIPLLVTSNSDQFLTTPDGDEKDITQD
NSELKHRSSKKDLLEIDRFTICGNRID

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6NXT6	1.000	1.000	3.629E-70	567	1.000	1.000	Q6NXT6.pdb.gz	TAPT1_HUMAN Transmembrane anterior posterior transformation protein 1 homolog OS=Homo sapiens OX=9606 GN=TAPT1 PE=1 SV=1
2	AFDB:A2BIE7	0.763	0.763	1.004E-54	567	0.765	0.765	A2BIE7.pdb.gz	TAPT1_DANRE Transmembrane anterior posterior transformation protein 1 homolog OS=Danio rerio OX=7955 GN=tapt1 PE=2 SV=1
3	AFDB:O60067	0.611	0.536	1.400E-21	649	0.249	0.217	O60067.pdb.gz	TAPT1_SCHPO Endoplasmic reticulum membrane protein 65 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC13G1.05 PE=1 SV=1
4	AFDB:F4HVJ3	0.584	0.532	1.641E-19	624	0.250	0.228	F4HVJ3.pdb.gz	POD1_ARATH Protein POLLEN DEFECTIVE IN GUIDANCE 1 OS=Arabidopsis thaliana OX=3702 GN=POD1 PE=1 SV=1
5	AFDB:P40085	0.578	0.589	3.795E-19	556	0.217	0.221	P40085.pdb.gz	TAPT1_YEAST Endoplasmic reticulum membrane protein 65 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EMP65 PE=1 SV=1
6	AFDB:Q9VPS7	0.118	0.071	9.117E-3	1305	0.106	0.046	Q9VPS7.pdb.gz	Q9VPS7_DROME Metabotropic GABA-B receptor subtype 3, isoform A OS=Drosophila melanogaster OX=7227 GN=GABA-B-R3 PE=1 SV=2
7	AFDB:P54683	0.111	0.055	9.528E-3	1906	0.093	0.028	P54683.pdb.gz	TAGB_DICDI Serine protease/ABC transporter B family protein tagB OS=Dictyostelium discoideum OX=44689 GN=tagB PE=3 SV=2
8	AFDB:Q8TF30	0.098	0.073	1.088E-2	809	0.099	0.069	Q8TF30.pdb.gz	WHAMM_HUMAN WASP homolog-associated protein with actin, membranes and microtubules OS=Homo sapiens OX=9606 GN=WHAMM PE=1 SV=2
9	AFDB:Q2KNE5	0.122	0.119	1.242E-2	593	0.116	0.111	Q2KNE5.pdb.gz	OPN4A_DANRE Melanopsin-A OS=Danio rerio OX=7955 GN=opn4a PE=2 SV=3
10	AFDB:A9ZLL8	0.101	0.081	1.356E-2	756	0.152	0.114	A9ZLL8.pdb.gz	LSD90_SCHPO Protein lsd90 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=lsd90 PE=1 SV=1
11	PDB:7vl9R	0.115	0.180	5.469E-2	302	0.074	0.139	7vl9R.pdb.gz	Identification and mechanism of G protein-biased ligands for chemokine receptor CCR1.
12	PDB:4u4tA	0.107	0.125	7.448E-2	444	0.078	0.099	4u4tA.pdb.gz	Structural basis for dynamic mechanism of nitrate/nitrite antiport by NarK
13	PDB:7mitE	0.116	0.058	1.060E-1	1438	0.058	0.023	7mitE.pdb.gz	Vascular K ATP channel structural dynamics reveal regulatory mechanism by Mg-nucleotides.
14	PDB:7vluA	0.135	0.075	1.381E-1	1159	0.048	0.023	7vluA.pdb.gz	Structural identification of vasodilator binding sites on the SUR2 subunit.
15	PDB:4jr9A	0.122	0.149	1.577E-1	409	0.095	0.132	4jr9A.pdb.gz	Crystal structure of a nitrate/nitrite exchanger.
16	PDB:5ogeG	0.086	0.135	1.881E-1	306	0.090	0.167	5ogeG.pdb.gz
17	PDB:7td1R	0.108	0.176	2.345E-1	293	0.072	0.140	7td1R.pdb.gz	Differential activation mechanisms of lipid GPCRs by lysophosphatidic acid and sphingosine 1-phosphate.
18	PDB:7rr9A	0.096	0.097	2.561E-1	560	0.062	0.062	7rr9A.pdb.gz	Structures of the human peroxisomal fatty acid transporter ABCD1 in a lipid environment
19	PDB:7p5jA	0.073	0.095	2.798E-1	399	0.065	0.093	7p5jA.pdb.gz
20	PDB:6g79S	0.091	0.152	3.338E-1	262	0.056	0.122	6g79S.pdb.gz	Cryo-EM structure of the serotonin 5-HT1Breceptor coupled to heterotrimeric Go.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2BIE7	0.0	841	567	0.774	0.774	TAPT1_DANRE Transmembrane anterior posterior transformation protein 1 homolog OS=Danio rerio OX=7955 GN=tapt1 PE=2 SV=1
2	Q4VBD2	0.0	1030	564	0.951	0.956	TAPT1_MOUSE Transmembrane anterior posterior transformation protein 1 OS=Mus musculus OX=10090 GN=Tapt1 PE=1 SV=2
3	Q6NXT6	0.0	1175	567	1.000	1.000	TAPT1_HUMAN Transmembrane anterior posterior transformation protein 1 homolog OS=Homo sapiens OX=9606 GN=TAPT1 PE=1 SV=1
4	O60067	9.42e-59	209	649	0.224	0.196	TAPT1_SCHPO Endoplasmic reticulum membrane protein 65 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC13G1.05 PE=1 SV=1
5	F4HVJ3	5.84e-52	189	624	0.236	0.215	POD1_ARATH Protein POLLEN DEFECTIVE IN GUIDANCE 1 OS=Arabidopsis thaliana OX=3702 GN=POD1 PE=1 SV=1
6	P40085	1.29e-43	165	556	0.208	0.212	TAPT1_YEAST Endoplasmic reticulum membrane protein 65 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EMP65 PE=1 SV=1
7	Q63870	0.24	37.0	2944	0.037	0.007	CO7A1_MOUSE Collagen alpha-1(VII) chain OS=Mus musculus OX=10090 GN=Col7a1 PE=1 SV=3
8	F1SKM1	0.56	35.8	2938	0.034	0.006	F1SKM1_PIG Collagen type VII alpha 1 chain OS=Sus scrofa OX=9823 GN=COL7A1 PE=4 SV=2
9	O18407	0.96	35.0	1761	0.037	0.012	O18407_DROME Collagen type IV alpha 2 OS=Drosophila melanogaster OX=7227 GN=vkg PE=1 SV=1
10	Q9VMV5	0.96	35.0	1940	0.037	0.011	Q9VMV5_DROME Viking, isoform A OS=Drosophila melanogaster OX=7227 GN=vkg PE=1 SV=1
11	Q3ZN08	1.2	33.9	260	0.042	0.092	F220A_MOUSE Protein FAM220A OS=Mus musculus OX=10090 GN=Fam220a PE=1 SV=1
12	P08572	1.9	33.9	1712	0.032	0.011	CO4A2_HUMAN Collagen alpha-2(IV) chain OS=Homo sapiens OX=9606 GN=COL4A2 PE=1 SV=4
13	P12107	2.6	33.5	1806	0.030	0.009	COBA1_HUMAN Collagen alpha-1(XI) chain OS=Homo sapiens OX=9606 GN=COL11A1 PE=1 SV=4
14	G5EE72	3.1	33.1	1427	0.051	0.020	MRP5_CAEEL Multidrug resistance-associated protein 5 OS=Caenorhabditis elegans OX=6239 GN=mrp-5 PE=2 SV=1
15	P25940	4.0	33.1	1745	0.028	0.009	CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens OX=9606 GN=COL5A3 PE=1 SV=3
16	Q9JLI2	7.1	32.3	1739	0.030	0.010	Q9JLI2_MOUSE Collagen type V alpha 3 chain OS=Mus musculus OX=10090 GN=Col5a3 PE=1 SV=1
17	F1RLL9	8.4	32.0	1712	0.032	0.011	F1RLL9_PIG Collagen type IV alpha 2 chain OS=Sus scrofa OX=9823 GN=COL4A2 PE=1 SV=3
18	A0A0S2Z6X0	8.6	30.4	149	0.035	0.134	A0A0S2Z6X0_HUMAN Zinc finger with KRAB and SCAN domains 4 isoform 3 OS=Homo sapiens OX=9606 GN=ZKSCAN4 PE=1 SV=1
19	F1R5X4	9.6	31.6	1721	0.030	0.010	F1R5X4_DANRE Collagen alpha-2(XI) chain isoform X6 OS=Danio rerio OX=7955 GN=col11a1 PE=1 SV=2
20	P08122	9.6	31.6	1707	0.034	0.011	CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus OX=10090 GN=Col4a2 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00214 Calc_CGRP_IAPP	64	15.6	Calcitonin / CGRP / IAPP family
2	PF08650 DASH_Dad4	1.5e+02	13.8	DASH complex subunit Dad4
3	PF05346 DUF747	6.8e-101	349.5	Eukaryotic membrane protein family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000385347

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000369407	0.781	Solute carrier family 25 member 35
2	9606.ENSP00000356696	0.769	SUN domain-containing ossification factor
3	9606.ENSP00000040584	0.764	Homeobox protein Hox-C8
4	9606.ENSP00000426255	0.732	Sorting nexin-25
5	9606.ENSP00000315017	0.731	Mitochondrial ribosomal protein L1
6	9606.ENSP00000226299	0.678	Cytosol aminopeptidase
7	9606.ENSP00000371201	0.672	Putative methyltransferase NSUN7
8	9606.ENSP00000425658	0.669	Ankyrin repeat domain-containing protein 50
9	9606.ENSP00000405068	0.661	Nucleolar protein 14
10	9606.ENSP00000306772	0.649	LIM domain-binding protein 2
11	9606.ENSP00000371661	0.645	Ligand-dependent nuclear receptor corepressor-like protein
12	9606.ENSP00000274008	0.642	Spermatogenesis-associated protein 5
13	9606.ENSP00000363250	0.641	GPN-loop GTPase 2
14	9606.ENSP00000353210	0.628	ADP-ribosylation factor-like protein 9
15	9606.ENSP00000362159	0.614	Calcium-binding mitochondrial carrier protein SCaMC-2
16	9606.ENSP00000384048	0.609	PAX-interacting protein 1
17	9606.ENSP00000422473	0.607	Transmembrane protein 33
18	9606.ENSP00000449884	0.601	Mitochondrial ribosomal protein L42
19	9606.ENSP00000316891	0.576	LIM and calponin homology domains 1
20	9606.ENSP00000219334	0.573	Sphingomyelin phosphodiesterase 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016520	1.000	growth hormone-releasing hormone receptor activity
GO:0005515	0.847	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.968	regulation of cellular process
GO:0048518	0.912	positive regulation of biological process
GO:0048522	0.882	positive regulation of cellular process
GO:0009987	0.862	cellular process
GO:0051128	0.764	regulation of cellular component organization
GO:0032501	0.730	multicellular organismal process
GO:0044087	0.674	regulation of cellular component biogenesis
GO:1902115	0.648	regulation of organelle assembly
GO:0031344	0.582	regulation of cell projection organization
GO:0032502	0.577	developmental process
GO:0120032	0.569	regulation of plasma membrane bounded cell projection assembly
GO:0051130	0.553	positive regulation of cellular component organization
GO:0044089	0.521	positive regulation of cellular component biogenesis
GO:0048856	0.498	anatomical structure development
GO:1902117	0.438	positive regulation of organelle assembly
GO:0031346	0.425	positive regulation of cell projection organization
GO:0007275	0.337	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005829	0.999	cytosol
GO:0005654	0.999	nucleoplasm
GO:0005856	0.995	cytoskeleton
GO:0005815	0.989	microtubule organizing center
GO:0120025	0.979	plasma membrane bounded cell projection
GO:0005813	0.973	centrosome
GO:0036064	0.966	ciliary basal body
GO:0012505	0.818	endomembrane system
GO:0031090	0.573	organelle membrane
GO:0032991	0.410	protein-containing complex
GO:0071944	0.329	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]