StarFunc result for job id Q6NYC1

User Input

>input (403 residues)
MNHKSKKRIREAKRSARPELKDSLDWTRHNYYESFSLSPAAVADNVERADALQLSVEEFV
ERYERPYKPVVLLNAQEGWSAQEKWTLERLKRKYRNQKFKCGEDNDGYSVKMKMKYYIEY
MESTRDDSPLYIFDSSYGEHPKRRKLLEDYKVPKFFTDDLFQYAGEKRRPPYRWFVMGPP
RSGTGIHIDPLGTSAWNALVQGHKRWCLFPTSTPRELIKVTRDEGGNQQDEAITWFNVIY
PRTQLPTWPPEFKPLEILQKPGETVFVPGGWWHVVLNLDTTIAITQNFASSTNFPVVWHK
TVRGRPKLSRKWYRILKQEHPELAVLADSVDLQESTGIASDSSSDSSSSSSSSSSDSDSE
CESGSEGDGTVHRRKKRRTCSMVGNGDTTSQDDCVSKERSSSR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6NYC1	1.000	1.000	1.094E-81	403	1.000	1.000	Q6NYC1.pdb.gz	JMJD6_HUMAN Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 OS=Homo sapiens OX=9606 GN=JMJD6 PE=1 SV=1
2	AFDB:Q6PFM0	0.909	0.909	3.347E-73	403	0.851	0.851	Q6PFM0.pdb.gz	JMJD6_DANRE Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 OS=Danio rerio OX=7955 GN=jmjd6 PE=2 SV=2
3	AFDB:B2WTI4	0.797	0.889	8.808E-67	361	0.779	0.870	B2WTI4.pdb.gz	B2WTI4_HUMAN Jumonji domain containing 6, arginine demethylase and lysine hydroxylase OS=Homo sapiens OX=9606 GN=JMJD6 PE=1 SV=1
4	AFDB:K7EJU9	0.787	0.803	2.934E-66	395	0.801	0.818	K7EJU9.pdb.gz	K7EJU9_HUMAN Jumonji domain containing 6, arginine demethylase and lysine hydroxylase OS=Homo sapiens OX=9606 GN=JMJD6 PE=1 SV=1
5	AFDB:Q9VD28	0.840	0.830	5.860E-61	408	0.635	0.627	Q9VD28.pdb.gz	JMJD6_DROME Bifunctional arginine demethylase and lysyl-hydroxylase PSR OS=Drosophila melanogaster OX=7227 GN=PSR PE=2 SV=1
6	AFDB:Q6Q4H1	0.880	0.920	8.568E-59	385	0.576	0.603	Q6Q4H1.pdb.gz	JMJD6_HYDVU Bifunctional arginine demethylase and lysyl-hydroxylase PSR OS=Hydra vulgaris OX=6087 GN=PSR PE=1 SV=1
7	AFDB:Q9GYI4	0.814	0.820	1.968E-50	400	0.504	0.507	Q9GYI4.pdb.gz	JMJD6_CAEEL Bifunctional arginine demethylase and lysyl-hydroxylase psr-1 OS=Caenorhabditis elegans OX=6239 GN=psr-1 PE=1 SV=2
8	AFDB:Q67XX3	0.626	0.506	6.986E-29	502	0.268	0.215	Q67XX3.pdb.gz	JMJ22_ARATH Arginine-specific demethylase JMJ22 OS=Arabidopsis thaliana OX=3702 GN=JMJ22 PE=1 SV=1
9	AFDB:Q386V9	0.599	0.445	1.548E-22	550	0.226	0.165	Q386V9.pdb.gz	Q386V9_TRYB2 JmjC domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.46.0007 PE=4 SV=1
10	AFDB:Q67ZB6	0.497	0.438	3.930E-18	462	0.184	0.160	Q67ZB6.pdb.gz	JMJ20_ARATH Arginine-specific demethylase JMJ20 OS=Arabidopsis thaliana OX=3702 GN=JMJ20 PE=1 SV=1
11	PDB:4qszA	0.432	0.264	4.740E-12	686	0.154	0.090	4qszA.pdb.gz	Crystal structure of mouse JMJd7 fused with maltose-binding protein
12	PDB:5nfnB	0.427	0.533	6.313E-12	318	0.146	0.186	5nfnB.pdb.gz	(3S)-Lysyl hydroxylation of TRAFAC GTPases is catalyzed by the human Jumonji-C oxygenase JMJD7.
13	PDB:3al5B	0.420	0.530	5.898E-11	311	0.144	0.186	3al5B.pdb.gz	Crystal structure of a novel JmjC-domain-containing protein, TYW5, involved in tRNA modification.
14	PDB:7yxgA	0.435	0.549	2.471E-10	313	0.144	0.185	7yxgA.pdb.gz	Conservation of the unusual dimeric JmjC fold of JMJD7 from Drosophila melanogaster to humans.
15	PDB:3al5C	0.408	0.561	2.771E-10	284	0.139	0.197	3al5C.pdb.gz	Crystal structure of a novel JmjC-domain-containing protein, TYW5, involved in tRNA modification.
16	PDB:4b7eA	0.403	0.454	4.543E-8	349	0.144	0.166	4b7eA.pdb.gz	Substrate selectivity analyses of factor inhibiting hypoxia-inducible factor.
17	PDB:4cclB	0.329	0.352	2.368E-6	372	0.089	0.097	4cclB.pdb.gz	Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
18	PDB:4bxfA	0.350	0.334	4.155E-5	425	0.089	0.085	4bxfA.pdb.gz	Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
19	PDB:4bu2A	0.319	0.336	4.935E-5	379	0.089	0.095	4bu2A.pdb.gz	Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
20	PDB:2vqaA	0.172	0.193	1.466E-4	356	0.055	0.062	2vqaA.pdb.gz	Protein-Folding Location Can Regulate Manganese-Binding Versus Copper- or Zinc-Binding.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B2WTI4	0.0	662	361	0.779	0.870	B2WTI4_HUMAN Jumonji domain containing 6, arginine demethylase and lysine hydroxylase OS=Homo sapiens OX=9606 GN=JMJD6 PE=1 SV=1
2	K7EJU9	0.0	662	395	0.777	0.792	K7EJU9_HUMAN Jumonji domain containing 6, arginine demethylase and lysine hydroxylase OS=Homo sapiens OX=9606 GN=JMJD6 PE=1 SV=1
3	Q6NYC1	0.0	838	403	1.000	1.000	JMJD6_HUMAN Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 OS=Homo sapiens OX=9606 GN=JMJD6 PE=1 SV=1
4	Q6PFM0	0.0	689	403	0.851	0.851	JMJD6_DANRE Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 OS=Danio rerio OX=7955 GN=jmjd6 PE=2 SV=2
5	Q9ERI5	0.0	823	403	0.978	0.978	JMJD6_MOUSE Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 OS=Mus musculus OX=10090 GN=Jmjd6 PE=1 SV=2
6	Q9VD28	0.0	517	408	0.591	0.583	JMJD6_DROME Bifunctional arginine demethylase and lysyl-hydroxylase PSR OS=Drosophila melanogaster OX=7227 GN=PSR PE=2 SV=1
7	Q6Q4H1	2.97e-162	462	385	0.524	0.548	JMJD6_HYDVU Bifunctional arginine demethylase and lysyl-hydroxylase PSR OS=Hydra vulgaris OX=6087 GN=PSR PE=1 SV=1
8	Q9GYI4	5.91e-134	391	400	0.454	0.458	JMJD6_CAEEL Bifunctional arginine demethylase and lysyl-hydroxylase psr-1 OS=Caenorhabditis elegans OX=6239 GN=psr-1 PE=1 SV=2
9	Q27GT3	2.02e-96	291	284	0.328	0.465	Q27GT3_CAEEL JmjC domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=psr-1 PE=1 SV=1
10	Q67XX3	1.46e-52	184	502	0.253	0.203	JMJ22_ARATH Arginine-specific demethylase JMJ22 OS=Arabidopsis thaliana OX=3702 GN=JMJ22 PE=1 SV=1
11	Q386V9	1.34e-32	130	550	0.208	0.153	Q386V9_TRYB2 JmjC domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.46.0007 PE=4 SV=1
12	Q67ZB6	4.54e-20	94.0	462	0.203	0.177	JMJ20_ARATH Arginine-specific demethylase JMJ20 OS=Arabidopsis thaliana OX=3702 GN=JMJ20 PE=1 SV=1
13	Q9H9V9	3.70e-18	88.2	463	0.206	0.179	JMJD4_HUMAN 2-oxoglutarate and iron-dependent oxygenase JMJD4 OS=Homo sapiens OX=9606 GN=JMJD4 PE=1 SV=2
14	Q9VJ97	9.23e-15	77.8	425	0.127	0.120	JMJD4_DROME 2-oxoglutarate and iron-dependent oxygenase JMJD4 homolog OS=Drosophila melanogaster OX=7227 GN=CG7200 PE=2 SV=1
15	Q96S16	1.96e-10	63.2	264	0.169	0.258	JMJD8_HUMAN JmjC domain-containing protein 8 OS=Homo sapiens OX=9606 GN=JMJD8 PE=1 SV=2
16	O13977	4.46e-10	63.5	464	0.109	0.095	JMJ1_SCHPO JmjC domain-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=jmj1 PE=4 SV=1
17	Q8RWR1	1.92e-07	55.1	429	0.144	0.135	JMJ30_ARATH Lysine-specific demethylase JMJ30 OS=Arabidopsis thaliana OX=3702 GN=JMJ30 PE=1 SV=1
18	O97101	4.55e-06	51.2	1000	0.166	0.067	CBFA_DICDI C-module-binding factor A OS=Dictyostelium discoideum OX=44689 GN=cbfA PE=1 SV=2
19	P0CH95	1.17e-05	50.1	1032	0.124	0.048	PHF8_DANRE Histone lysine demethylase PHF8 OS=Danio rerio OX=7955 GN=phf8 PE=1 SV=1
20	Q386X8	3.76e-05	48.1	450	0.097	0.087	Q386X8_TRYB2 JmjC domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.55.0004 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05110 AF-4	1.4e+02	13.1	AF-4 proto-oncoprotein N-terminal region
2	PF13621 Cupin_8	3.7e-16	71.3	Cupin-like domain
3	PF11279 DUF3080	2.4e+02	12.3	Protein of unknown function (DUF3080)
4	PF15761 IMUP	3.6e+02	13.3	Immortalisation up-regulated protein
5	PF02373 JmjC	2.5e-26	103.8	JmjC domain, hydroxylase
6	PF08007 JmjC_2	2.5e+02	12.6	JmjC domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000394085

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263377	0.999	Bromodomain-containing protein 4
2	9606.ENSP00000307863	0.911	Splicing factor U2AF 65 kDa subunit
3	9606.ENSP00000252599	0.900	Procollagen galactosyltransferase 1
4	9606.ENSP00000354960	0.900	Procollagen galactosyltransferase 2
5	9606.ENSP00000269305	0.806	Cellular tumor antigen p53
6	9606.ENSP00000312185	0.805	Engulfment and cell motility protein 1
7	9606.ENSP00000377681	0.784	Ras GTPase-activating protein-binding protein 1
8	9606.ENSP00000362361	0.775	Cyclin-dependent kinase 9
9	9606.ENSP00000398410	0.767	JmjC domain-containing protein 5
10	9606.ENSP00000293872	0.728	Putative RNA-binding protein Luc7-like 1
11	9606.ENSP00000380467	0.713	JmjC domain-containing protein 7
12	9606.ENSP00000347005	0.711	Putative RNA-binding protein Luc7-like 2
13	9606.ENSP00000363193	0.711	Mediator of RNA polymerase II transcription subunit 12
14	9606.ENSP00000346627	0.697	tRNA wybutosine-synthesizing protein 5
15	9606.ENSP00000386458	0.679	Pre-mRNA-processing factor 40 homolog A
16	9606.ENSP00000378704	0.675	Bromodomain-containing protein 2
17	9606.ENSP00000313983	0.653	Histone-lysine N-methyltransferase NSD3
18	9606.ENSP00000386289	0.648	PTB domain-containing engulfment adapter protein 1
19	9606.ENSP00000244537	0.643	Histone cluster 1 H4 family member f
20	9606.ENSP00000300574	0.642	Adapter molecule crk

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0003723	1.000	RNA binding
GO:0140096	0.997	catalytic activity, acting on a protein
GO:0016706	0.995	2-oxoglutarate-dependent dioxygenase activity
GO:0032452	0.993	histone demethylase activity
GO:0046914	0.939	transition metal ion binding
GO:0005506	0.930	iron ion binding
GO:0140098	0.920	catalytic activity, acting on RNA
GO:0003727	0.715	single-stranded RNA binding
GO:0098772	0.706	molecular function regulator activity
GO:0044877	0.697	protein-containing complex binding
GO:0140677	0.675	molecular function activator activity
GO:0033749	0.381	histone H3R3 demethylase activity
GO:0033746	0.381	histone H3R2 demethylase activity
GO:0035515	0.327	oxidative RNA demethylase activity
GO:0070815	0.321	peptidyl-lysine 5-dioxygenase activity
GO:0106140	0.319	P-TEFb complex binding
GO:0140537	0.308	transcription regulator activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.976	regulation of biological process
GO:0009987	0.973	cellular process
GO:0050794	0.964	regulation of cellular process
GO:0019222	0.711	regulation of metabolic process
GO:0060255	0.700	regulation of macromolecule metabolic process
GO:0080090	0.695	regulation of primary metabolic process
GO:0051171	0.695	regulation of nitrogen compound metabolic process
GO:0031323	0.695	regulation of cellular metabolic process
GO:0010468	0.693	regulation of gene expression
GO:0019219	0.624	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.607	regulation of RNA metabolic process
GO:0006807	0.520	nitrogen compound metabolic process
GO:0071704	0.514	organic substance metabolic process
GO:0044238	0.504	primary metabolic process
GO:0043170	0.384	macromolecule metabolic process
GO:0009889	0.382	regulation of biosynthetic process
GO:0044237	0.381	cellular metabolic process
GO:0048518	0.377	positive regulation of biological process
GO:0071840	0.330	cellular component organization or biogenesis
GO:0016043	0.311	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.990	cytoplasm
GO:0043232	0.948	intracellular non-membrane-bounded organelle
GO:0005730	0.631	nucleolus
GO:0005829	0.320	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.14.11.-	0.995	With 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors.

[back to server]