StarFunc result for job id Q6NZY7

User Input

>input (148 residues)
MPVLKQLGPAQPKKRPDRGALSISAPLGDFRHTLHVGRGGDAFGDTSFLSRHGGGPPPEP
RAPPAGAPRSPPPPAVPQSAAPSPADPLLSFHLDLGPSMLDAVLGVMDAARPEAAAAKPD
AEPRPGTQPPQARCRPNADLELNDVIGL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6NZY7	0.999	0.999	3.478E-23	148	1.000	1.000	Q6NZY7.pdb.gz	BORG3_HUMAN Cdc42 effector protein 5 OS=Homo sapiens OX=9606 GN=CDC42EP5 PE=2 SV=1
2	AFDB:Q9Z0X0	0.378	0.374	7.189E-16	150	0.804	0.793	Q9Z0X0.pdb.gz	BORG3_MOUSE Cdc42 effector protein 5 OS=Mus musculus OX=10090 GN=Cdc42ep5 PE=1 SV=2
3	AFDB:B2R6D8	0.186	0.087	2.063E-4	356	0.500	0.208	B2R6D8.pdb.gz	B2R6D8_HUMAN CDC42 effector protein (Rho GTPase binding) 4, isoform CRA_a OS=Homo sapiens OX=9606 GN=CDC42EP4 PE=2 SV=1
4	AFDB:Q9JM96	0.173	0.085	2.886E-3	349	0.453	0.192	Q9JM96.pdb.gz	BORG4_MOUSE Cdc42 effector protein 4 OS=Mus musculus OX=10090 GN=Cdc42ep4 PE=1 SV=1
5	AFDB:G5EF02	0.178	0.084	8.474E-1	351	0.115	0.048	G5EF02.pdb.gz	G5EF02_CAEEL PIP-1 OS=Caenorhabditis elegans OX=6239 GN=spn-4 PE=1 SV=1
6	AFDB:Q22914	0.148	0.078	2.501	373	0.142	0.056	Q22914.pdb.gz	Q22914_CAEEL Ground-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=grd-8 PE=4 SV=2
7	AFDB:Q9I7F7	0.123	0.025	3.508	1337	0.203	0.022	Q9I7F7.pdb.gz	ACKL_DROME Activated Cdc42 kinase-like OS=Drosophila melanogaster OX=7227 GN=Ack-like PE=1 SV=3
8	AFDB:Q8MS11	0.170	0.088	4.598	327	0.095	0.043	Q8MS11.pdb.gz	Q8MS11_DROME RE74901p OS=Drosophila melanogaster OX=7227 GN=CG14220 PE=2 SV=1
9	AFDB:Q9NR83	0.150	0.076	5.264	387	0.250	0.096	Q9NR83.pdb.gz	S2A4R_HUMAN SLC2A4 regulator OS=Homo sapiens OX=9606 GN=SLC2A4RG PE=1 SV=4
10	AFDB:F1LTH0	0.134	0.036	6.027	967	0.176	0.027	F1LTH0.pdb.gz	F1LTH0_RAT Zinc finger protein 473 OS=Rattus norvegicus OX=10116 GN=Zfp473 PE=4 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6NZY7	5.23e-99	282	148	1.000	1.000	BORG3_HUMAN Cdc42 effector protein 5 OS=Homo sapiens OX=9606 GN=CDC42EP5 PE=2 SV=1
2	Q9Z0X0	3.79e-62	189	150	0.791	0.780	BORG3_MOUSE Cdc42 effector protein 5 OS=Mus musculus OX=10090 GN=Cdc42ep5 PE=1 SV=2
3	J3KRZ9	1.13e-16	73.2	127	0.250	0.291	J3KRZ9_HUMAN CDC42 effector protein 4 (Fragment) OS=Homo sapiens OX=9606 GN=CDC42EP4 PE=1 SV=1
4	B2R6D8	1.03e-14	71.6	356	0.250	0.104	B2R6D8_HUMAN CDC42 effector protein (Rho GTPase binding) 4, isoform CRA_a OS=Homo sapiens OX=9606 GN=CDC42EP4 PE=2 SV=1
5	Q9H3Q1	1.03e-14	71.6	356	0.250	0.104	BORG4_HUMAN Cdc42 effector protein 4 OS=Homo sapiens OX=9606 GN=CDC42EP4 PE=1 SV=1
6	Q9JM96	5.97e-14	69.7	349	0.230	0.097	BORG4_MOUSE Cdc42 effector protein 4 OS=Mus musculus OX=10090 GN=Cdc42ep4 PE=1 SV=1
7	Q00587	2.57e-13	67.8	391	0.230	0.087	BORG5_HUMAN Cdc42 effector protein 1 OS=Homo sapiens OX=9606 GN=CDC42EP1 PE=1 SV=1
8	Q91W92	1.39e-12	65.9	409	0.203	0.073	BORG5_MOUSE Cdc42 effector protein 1 OS=Mus musculus OX=10090 GN=Cdc42ep1 PE=1 SV=1
9	Q8JZX9	2.50e-07	50.1	214	0.189	0.131	BORG1_MOUSE Cdc42 effector protein 2 OS=Mus musculus OX=10090 GN=Cdc42ep2 PE=1 SV=1
10	O14613	2.60e-07	50.1	210	0.189	0.133	BORG1_HUMAN Cdc42 effector protein 2 OS=Homo sapiens OX=9606 GN=CDC42EP2 PE=1 SV=1
11	Q9UKI2	1.13e-05	45.8	254	0.135	0.079	BORG2_HUMAN Cdc42 effector protein 3 OS=Homo sapiens OX=9606 GN=CDC42EP3 PE=1 SV=1
12	C9JEZ4	1.29e-05	45.4	215	0.135	0.093	C9JEZ4_HUMAN CDC42 effector protein 3 (Fragment) OS=Homo sapiens OX=9606 GN=CDC42EP3 PE=1 SV=8
13	Q9CQC5	1.37e-05	45.4	254	0.135	0.079	BORG2_MOUSE Cdc42 effector protein 3 OS=Mus musculus OX=10090 GN=Cdc42ep3 PE=1 SV=1
14	G5EBZ8	0.002	39.7	1043	0.115	0.016	ARK1_CAEEL Ack-related non-receptor tyrosine kinase OS=Caenorhabditis elegans OX=6239 GN=ark-1 PE=2 SV=1
15	Q9I7F7	0.006	38.1	1337	0.128	0.014	ACKL_DROME Activated Cdc42 kinase-like OS=Drosophila melanogaster OX=7227 GN=Ack-like PE=1 SV=3
16	O44224	0.026	36.2	830	0.122	0.022	O44224_DROME Miranda OS=Drosophila melanogaster OX=7227 GN=mira PE=2 SV=1
17	O45116	0.033	36.2	830	0.122	0.022	O45116_DROME Miranda OS=Drosophila melanogaster OX=7227 GN=mira PE=2 SV=1
18	Q9VDR7	0.039	35.8	829	0.122	0.022	Q9VDR7_DROME Miranda, isoform A OS=Drosophila melanogaster OX=7227 GN=mira PE=1 SV=2
19	A0A0B4KHS3	0.045	35.4	805	0.122	0.022	A0A0B4KHS3_DROME Miranda, isoform C OS=Drosophila melanogaster OX=7227 GN=mira PE=4 SV=1
20	Q8IN63	0.051	35.4	799	0.122	0.023	Q8IN63_DROME LD02989p OS=Drosophila melanogaster OX=7227 GN=mira PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14957 BORG_CEP	2.6e-06	40.0	Cdc42 effector
2	PF00786 PBD	0.0037	28.9	P21-Rho-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000301200

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000279249	0.990	Cdc42 effector protein 2
2	9606.ENSP00000295324	0.989	Cdc42 effector protein 3
3	9606.ENSP00000381992	0.973	Septin-7
4	9606.ENSP00000383118	0.903	Cell division control protein 42 homolog
5	9606.ENSP00000261845	0.900	Mitogen-activated protein kinase 6
6	9606.ENSP00000449381	0.900	MAP kinase-activated protein kinase 5
7	9606.ENSP00000341524	0.741	Septin-6
8	9606.ENSP00000238738	0.737	Rho-related GTP-binding protein RhoQ
9	9606.ENSP00000479861	0.623	Septin-2
10	9606.ENSP00000444628	0.622	Beta-galactosidase-1-like protein 2
11	9606.ENSP00000318374	0.614	Leukocyte receptor cluster member 8
12	9606.ENSP00000283474	0.556	UBA-like domain-containing protein 1
13	9606.ENSP00000444503	0.543	Homeobox protein SEBOX
14	9606.ENSP00000342832	0.521	Protein yippee-like 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031267	1.000	small GTPase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.994	regulation of cellular process
GO:0009987	0.989	cellular process
GO:0010638	0.984	positive regulation of organelle organization
GO:0120034	0.981	positive regulation of plasma membrane bounded cell projection assembly
GO:0016043	0.969	cellular component organization
GO:0032956	0.957	regulation of actin cytoskeleton organization
GO:1902905	0.944	positive regulation of supramolecular fiber organization
GO:0051495	0.944	positive regulation of cytoskeleton organization
GO:0110053	0.942	regulation of actin filament organization
GO:0043254	0.941	regulation of protein-containing complex assembly
GO:0008360	0.929	regulation of cell shape
GO:0030833	0.928	regulation of actin filament polymerization
GO:0030838	0.921	positive regulation of actin filament polymerization
GO:0050896	0.372	response to stimulus
GO:0051716	0.306	cellular response to stimulus
GO:0007165	0.301	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0016020	0.998	membrane
GO:0005829	0.993	cytosol
GO:0071944	0.976	cell periphery
GO:0043229	0.823	intracellular organelle
GO:0005886	0.577	plasma membrane
GO:0043232	0.493	intracellular non-membrane-bounded organelle
GO:0043227	0.367	membrane-bounded organelle
GO:0043231	0.356	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]