StarFunc result for job id Q6P087

User Input

>input (351 residues)
MRAVLAREMDGRRVLGRFWSGWRRGLGVRPVPEDAGFGTEARHQRQPRGSCQRSGPLGDQ
PFAGLLPKNLSREELVDALRAAVVDRKGPLVTLNKPQGLPVTGKPGELTLFSVLPELSQS
LGLREQELQVVRASGKESSGLVLLSSCPQTASRLQKYFTHARRAQRPTATYCAVTDGIPA
ASEGKIQAALKLEHIDGVNLTVPVKAPSRKDILEGVKKTLSHFRVVATGSGCALVQLQPL
TVFSSQLQVHMVLQLCPVLGDHMYSARVGTVLGQRFLLPAENNKPQRQVLDEALLRRLHL
TPSQAAQLPLHLHLHRLLLPGTRARDTPVELLAPLPPYFSRTLQCLGLRLQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6P087	1.000	1.000	6.660E-72	351	1.000	1.000	Q6P087.pdb.gz	RUSD3_HUMAN Mitochondrial mRNA pseudouridine synthase RPUSD3 OS=Homo sapiens OX=9606 GN=RPUSD3 PE=1 SV=3
2	AFDB:Q9CWX4	0.670	0.625	1.959E-25	377	0.268	0.249	Q9CWX4.pdb.gz	RUSD4_MOUSE Pseudouridylate synthase RPUSD4, mitochondrial OS=Mus musculus OX=10090 GN=Rpusd4 PE=2 SV=1
3	AFDB:Q96CM3	0.682	0.637	7.044E-24	377	0.259	0.241	Q96CM3.pdb.gz	RUSD4_HUMAN Pseudouridylate synthase RPUSD4, mitochondrial OS=Homo sapiens OX=9606 GN=RPUSD4 PE=1 SV=1
4	PDB:6yxxEC	0.615	0.581	3.032E-19	373	0.185	0.174	6yxxEC.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
5	AFDB:Q9LT72	0.596	0.447	3.012E-17	477	0.191	0.140	Q9LT72.pdb.gz	PUS4_ARATH RNA pseudouridine synthase 4, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At3g19440 PE=2 SV=1
6	AFDB:Q5XET6	0.570	0.430	5.420E-17	478	0.199	0.146	Q5XET6.pdb.gz	PUS3_ARATH RNA pseudouridine synthase 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g78910 PE=2 SV=1
7	PDB:2i82A	0.466	0.717	5.439E-14	217	0.140	0.226	2i82A.pdb.gz	Crystal structure of pseudouridine synthase RluA: indirect sequence readout through protein-induced RNA structure
8	PDB:2istA	0.538	0.583	1.223E-12	321	0.137	0.150	2istA.pdb.gz
9	PDB:2olwA	0.286	0.520	3.631E-5	179	0.074	0.145	2olwA.pdb.gz
10	PDB:7v9aC	0.269	0.244	6.842E-4	393	0.077	0.069	7v9aC.pdb.gz	Zipper head mechanism of telomere synthesis by human telomerase.
11	PDB:2rfkA	0.283	0.296	1.557E-3	334	0.077	0.081	2rfkA.pdb.gz	Substrate RNA positioning in the archaeal H/ACA ribonucleoprotein complex.
12	PDB:1sgvB	0.241	0.304	4.752E-3	266	0.063	0.083	1sgvB.pdb.gz
13	PDB:1k8wA	0.299	0.338	5.039E-3	304	0.054	0.062	1k8wA.pdb.gz	Cocrystal structure of a tRNA Psi55 pseudouridine synthase: nucleotide flipping by an RNA-modifying enzyme.
14	PDB:3dh3B	0.277	0.382	5.039E-3	241	0.088	0.129	3dh3B.pdb.gz	Crystal structure of an RluF-RNA complex: a base-pair rearrangement is the key to selectivity of RluF for U2604 of the ribosome.
15	PDB:1kskA	0.277	0.396	8.061E-3	234	0.111	0.167	1kskA.pdb.gz	Structure of the 16S rRNA pseudouridine synthase RsuA bound to uracil and UMP.
16	AFDB:Q6DBQ1	0.089	0.098	9.232E-3	299	0.100	0.117	Q6DBQ1.pdb.gz	AHL25_ARATH AT-hook motif nuclear-localized protein 25 OS=Arabidopsis thaliana OX=3702 GN=AHL25 PE=1 SV=1
17	AFDB:P9WIM9	0.087	0.096	1.238E-2	310	0.131	0.148	P9WIM9.pdb.gz	PR28_MYCTU Proline-rich 28 kDa antigen OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=mtc28 PE=1 SV=1
18	AFDB:Q8GXB3	0.070	0.067	1.868E-2	378	0.105	0.098	Q8GXB3.pdb.gz	AHL5_ARATH AT-hook motif nuclear-localized protein 5 OS=Arabidopsis thaliana OX=3702 GN=AHL5 PE=1 SV=1
19	AFDB:O80834	0.082	0.082	1.845E-1	348	0.091	0.092	O80834.pdb.gz	AHL9_ARATH AT-hook motif nuclear-localized protein 9 OS=Arabidopsis thaliana OX=3702 GN=AHL9 PE=2 SV=1
20	AFDB:Q9P7Y8	0.062	0.038	2.624E-1	706	0.088	0.044	Q9P7Y8.pdb.gz	MID2_SCHPO Septin ring organizing protein mid2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mid2 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6P087	0.0	700	351	1.000	1.000	RUSD3_HUMAN Mitochondrial mRNA pseudouridine synthase RPUSD3 OS=Homo sapiens OX=9606 GN=RPUSD3 PE=1 SV=3
2	Q96CM3	1.91e-25	107	377	0.245	0.228	RUSD4_HUMAN Pseudouridylate synthase RPUSD4, mitochondrial OS=Homo sapiens OX=9606 GN=RPUSD4 PE=1 SV=1
3	Q9CWX4	4.38e-23	100	377	0.262	0.244	RUSD4_MOUSE Pseudouridylate synthase RPUSD4, mitochondrial OS=Mus musculus OX=10090 GN=Rpusd4 PE=2 SV=1
4	Q38FJ3	1.56e-08	58.2	406	0.171	0.148	Q38FJ3_TRYB2 Pseudouridylate synthase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.2000 PE=1 SV=1
5	Q5XET6	6.65e-07	53.1	478	0.185	0.136	PUS3_ARATH RNA pseudouridine synthase 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g78910 PE=2 SV=1
6	P0AA37	7.20e-07	51.6	219	0.160	0.256	RLUA_ECOLI Dual-specificity RNA pseudouridine synthase RluA OS=Escherichia coli (strain K12) OX=83333 GN=rluA PE=1 SV=2
7	Q9LT72	1.63e-05	48.9	477	0.185	0.136	PUS4_ARATH RNA pseudouridine synthase 4, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At3g19440 PE=2 SV=1
8	Q12069	0.003	42.0	462	0.125	0.095	PUS9_YEAST tRNA pseudouridine(32) synthase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PUS9 PE=1 SV=1
9	Q09709	0.12	36.6	394	0.128	0.114	YA32_SCHPO Pseudouridylate synthase C18B11.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC18B11.02c PE=3 SV=1
10	Q12362	0.30	35.4	591	0.160	0.095	RIB2_YEAST Bifunctional protein RIB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RIB2 PE=1 SV=1
11	Q56062	0.48	34.7	295	0.097	0.115	PRPB_SALTY 2-methylisocitrate lyase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=prpB PE=1 SV=3
12	Q3ECD0	0.88	33.9	430	0.088	0.072	PUS2_ARATH RNA pseudouridine synthase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At1g76050 PE=2 SV=1
13	Q9VAG5	0.92	34.3	1961	0.085	0.015	Q9VAG5_DROME Claret, isoform A OS=Drosophila melanogaster OX=7227 GN=ca PE=1 SV=4
14	Q8IZ73	1.2	33.5	545	0.134	0.086	RUSD2_HUMAN Pseudouridylate synthase RPUSD2 OS=Homo sapiens OX=9606 GN=RPUSD2 PE=1 SV=2
15	P77541	2.0	32.3	296	0.080	0.095	PRPB_ECOLI 2-methylisocitrate lyase OS=Escherichia coli (strain K12) OX=83333 GN=prpB PE=1 SV=3
16	Q9FHM4	2.5	32.7	707	0.054	0.027	MA653_ARATH 65-kDa microtubule-associated protein 3 OS=Arabidopsis thaliana OX=3702 GN=MAP65-3 PE=1 SV=1
17	P0AA39	3.6	32.0	319	0.148	0.163	RLUC_ECOLI Ribosomal large subunit pseudouridine synthase C OS=Escherichia coli (strain K12) OX=83333 GN=rluC PE=1 SV=1
18	M9MRH0	7.1	31.2	543	0.131	0.085	M9MRH0_DROME RluA pseudouridine synthase 2, isoform C OS=Drosophila melanogaster OX=7227 GN=RluA-2 PE=1 SV=1
19	Q9VKU8	7.5	31.2	547	0.131	0.084	Q9VKU8_DROME LD40728p OS=Drosophila melanogaster OX=7227 GN=RluA-2 PE=1 SV=2
20	O82318	8.1	31.2	960	0.074	0.027	SKM1_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase SKM1 OS=Arabidopsis thaliana OX=3702 GN=SKM1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18986 DUF5719	1.9e+02	12.5	Family of unknown function (DUF5719)
2	PF00849 PseudoU_synth_2	9.6e-17	73.0	RNA pseudouridylate synthase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000373331

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361982	0.854	Mitochondrial mRNA pseudouridine synthase TRUB2
2	9606.ENSP00000365837	0.781	tRNA pseudouridine synthase A
3	9606.ENSP00000368389	0.772	Neugrin
4	9606.ENSP00000348722	0.759	Pseudouridylate synthase that catalyzes pseudouridylation of RNAs . Acts as a regulator of protein synthesis in embryonic stem cells by mediating pseudouridylation of RNA fragments derived from tRNAs (tRFs): pseudouridylated tRFs inhibit translation by targeting the translation initiation complex . Also catalyzes pseudouridylation of mRNAs: mediates pseudouridylation of mRNAs with the consensus sequence 5'-UGUAG-3' . In addition to mRNAs and tRNAs, binds other types of RNAs, such as snRNAs, Y RNAs and vault RNAs, suggesting that it can catalyze pseudouridylation of many RNA types
5	9606.ENSP00000415899	0.758	Pseudouridylate synthase that catalyzes pseudouridylation of RNAs
6	9606.ENSP00000323288	0.745	RNA pseudouridylate synthase domain containing 2
7	9606.ENSP00000236980	0.740	FAST kinase domain-containing protein 2, mitochondrial
8	9606.ENSP00000417602	0.736	Belongs to the universal ribosomal protein uL29 family.
9	9606.ENSP00000455026	0.735	RNA pseudouridylate synthase domain containing 1
10	9606.ENSP00000227474	0.720	tRNA pseudouridine(38/39) synthase
11	9606.ENSP00000480364	0.708	RCC1-like G exchanging factor-like protein
12	9606.ENSP00000351644	0.679	tRNA modification GTPase GTPBP3, mitochondrial
13	9606.ENSP00000368318	0.676	Pseudouridylate synthase-like 1
14	9606.ENSP00000481559	0.664	rRNA methyltransferase 1, mitochondrial
15	9606.ENSP00000298746	0.628	Probable tRNA pseudouridine synthase 1
16	9606.ENSP00000400513	0.621	FAST kinase domain-containing protein 1, mitochondrial
17	9606.ENSP00000292478	0.617	Pentatricopeptide repeat-containing protein 1, mitochondrial
18	9606.ENSP00000372445	0.616	Methyltransferase-like protein 17, mitochondrial
19	9606.ENSP00000400168	0.607	ATP5J2-PTCD1 readthrough
20	9606.ENSP00000254928	0.586	GTPase Era, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0003824	0.573	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.953	regulation of biological process
GO:0050794	0.942	regulation of cellular process
GO:0045727	0.929	positive regulation of translation
GO:0062125	0.912	regulation of mitochondrial gene expression
GO:0070129	0.871	regulation of mitochondrial translation
GO:0009987	0.706	cellular process
GO:0071704	0.702	organic substance metabolic process
GO:0044238	0.693	primary metabolic process
GO:0044237	0.693	cellular metabolic process
GO:0006807	0.682	nitrogen compound metabolic process
GO:0043170	0.663	macromolecule metabolic process
GO:0034641	0.628	cellular nitrogen compound metabolic process
GO:0090304	0.590	nucleic acid metabolic process
GO:0016070	0.470	RNA metabolic process
GO:0009451	0.447	RNA modification
GO:0010467	0.431	gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0035770	0.992	ribonucleoprotein granule
GO:0043233	0.495	organelle lumen
GO:0070013	0.489	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]