StarFunc result for job id Q6P0N0

User Input

>input (1132 residues)
MIATPLKHSRIYLPPEASSQRRNLPMDAIFFDSIPSGTLTPVKDLVKYQNSSLKLNDHKK
NQFLKMTTFNNKNIFQSTMLTEATTSNSSLDISAIKPNKDGLKNKANYESPGKIFLRMKE
KVLRDKQEQPSRNSSLLEPQKSGNNETFTPNRVEKKKLQHTYLCEEKENNKSFQSDDSSL
RASVQGVPLESSNNDIFLPVKQKIQCQQEKKAPLHNLTYELPTLNQEQENFLAVEARNKT
LTRAQLAKQIFHSKESIVATTKSKKDTFVLESVDSADEQFQNTNAETLSTNCIPIKNGSL
LMVSDSERTTEGTSQQKVKEGNGKTVPGETGLPGSMKDTCKIVLATPRLHITIPRRSKRN
ISKLSPPRIFQTVTNGLKKNQVVQLQEWMIKSINNNTAICVEGKLIDVTNIYWHSNVIIE
RIEHNKLRTISGNVYILKGMIDQISMKEAGYPNYLIRKFMFGFPENWKEHIDNFLEQLRA
GEKNREKTKQKQKTGRSVRDIRKSMKNDARENQTDTAQRATTTYDFDCDNLELKSNKHSE
SPGATELNMCHSNCQNKPTLRFPDDQVNNTIQNGGGDDLSNQELIGKKEYKMSSKKLKIG
ERTNERIIKSQKQETTEELDVSIDILTSREQFFSDEERKYMAINQKKAYILVTPLKSRKV
IEQRCMRYNLSAGTIKAVTDFVIPECQKKSPISKSMGTLENTFEGHKSKNKEDCDERDLL
TVNRKIKISNLEKEQMLTSDFKKNTRLLPKLKKIENQVAMSFYKHQSSPDLSSEESETEK
EIKRKAEVKKTKAGNTKEAVVHLRKSTRNTSNIPVILEPETEESENEFYIKQKKARPSVK
ETLQKSGVRKEFPITEAVGSDKTNRHPLECLPGLIQDKEWNEKELQKLHCAFASLPKHKP
GFWSEVAAAVGSRSPEECQRKYMENPRGKGSQKHVTKKKPANSKGQNGKRGDADQKQTIK
ITAKVGTLKRKQQMREFLEQLPKDDHDDFFSTTPLQHQRILLPSFQDSEDDDDILPNMDK
NPTTPSSVIFPLVKTPQCQHVSPGMLGSINRNDCDKYVFRMQKYHKSNGGIVWGNIKKKL
VETDFSTPTPRRKTPFNTDLGENSGIGKLFTNAVESLDEEEKDYYFSNSDSA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6P0N0	1.000	1.000	0.000	1132	1.000	1.000	Q6P0N0.pdb.gz	M18BP_HUMAN Mis18-binding protein 1 OS=Homo sapiens OX=9606 GN=MIS18BP1 PE=1 SV=1
2	AFDB:Q5JRA6	0.051	0.034	5.603E-3	1907	0.136	0.081	Q5JRA6.pdb.gz	TGO1_HUMAN Transport and Golgi organization protein 1 homolog OS=Homo sapiens OX=9606 GN=MIA3 PE=1 SV=1
3	AFDB:Q9NJB5	0.039	0.040	5.603E-3	1081	0.127	0.133	Q9NJB5.pdb.gz	ONEC_DROME Homeobox protein onecut OS=Drosophila melanogaster OX=7227 GN=onecut PE=2 SV=2
4	AFDB:Q8BI84	0.047	0.029	7.582E-3	1930	0.125	0.073	Q8BI84.pdb.gz	TGO1_MOUSE Transport and Golgi organization protein 1 homolog OS=Mus musculus OX=10090 GN=Mia3 PE=1 SV=2
5	AFDB:Q9VXJ5	0.042	0.039	8.557E-3	1311	0.133	0.115	Q9VXJ5.pdb.gz	Q9VXJ5_DROME Disco-related, isoform A OS=Drosophila melanogaster OX=7227 GN=disco-r PE=4 SV=3
6	AFDB:Q8I398	0.050	0.035	9.091E-3	2112	0.140	0.075	Q8I398.pdb.gz	Q8I398_PLAF7 Nucleoporin NUP221, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0905100 PE=4 SV=1
7	PDB:2cjjA	0.043	0.709	2.260E-2	63	0.015	0.270	2cjjA.pdb.gz
8	AFDB:P10180	0.041	0.027	2.543E-2	2175	0.133	0.069	P10180.pdb.gz	CUT_DROME Homeobox protein cut OS=Drosophila melanogaster OX=7227 GN=ct PE=1 SV=1
9	AFDB:Q9LR70	0.040	0.048	2.701E-2	801	0.097	0.137	Q9LR70.pdb.gz	Q9LR70_ARATH H/ACA ribonucleoprotein complex non-core subunit NAF1 OS=Arabidopsis thaliana OX=3702 GN=NAF1 PE=1 SV=1
10	AFDB:A2BIH4	0.044	0.043	4.947E-2	1169	0.129	0.125	A2BIH4.pdb.gz	A2BIH4_DANRE Zinc finger protein 644a OS=Danio rerio OX=7955 GN=fi40c02 PE=4 SV=1
11	AFDB:Q8GY51	0.048	0.050	4.947E-2	1059	0.140	0.149	Q8GY51.pdb.gz	Q8GY51_ARATH At4g15730 OS=Arabidopsis thaliana OX=3702 GN=DL3905C PE=2 SV=1
12	PDB:6lthO	0.041	0.133	5.949E-2	325	0.020	0.071	6lthO.pdb.gz	Structure of nucleosome-bound human BAF complex.
13	PDB:6k15H	0.039	0.108	3.047E-1	393	0.011	0.031	6k15H.pdb.gz	Structure of the RSC complex bound to the nucleosome.
14	PDB:7vdvW	0.040	0.177	3.047E-1	248	0.013	0.060	7vdvW.pdb.gz	Structure of human chromatin-remodelling PBAF complex bound to a nucleosome.
15	PDB:2hi3A	0.042	0.459	3.237E-1	73	0.011	0.178	2hi3A.pdb.gz
16	PDB:6id0L	0.042	0.095	3.439E-1	475	0.023	0.055	6id0L.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
17	PDB:6iczL	0.041	0.095	4.380E-1	454	0.027	0.066	6iczL.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
18	PDB:5yzgL	0.043	0.108	7.107E-1	419	0.027	0.074	5yzgL.pdb.gz	Structure of a human catalytic step I spliceosome
19	PDB:6qdvO	0.041	0.102	7.107E-1	441	0.027	0.068	6qdvO.pdb.gz	A human postcatalytic spliceosome structure reveals essential roles of metazoan factors for exon ligation.
20	PDB:7vdvX	0.037	0.161	7.107E-1	252	0.015	0.067	7vdvX.pdb.gz	Structure of human chromatin-remodelling PBAF complex bound to a nucleosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6P0N0	0.0	2341	1132	1.000	1.000	M18BP_HUMAN Mis18-binding protein 1 OS=Homo sapiens OX=9606 GN=MIS18BP1 PE=1 SV=1
2	Q80WQ8	1.37e-168	526	998	0.252	0.286	M18BP_MOUSE Mis18-binding protein 1 OS=Mus musculus OX=10090 GN=Mis18bp1 PE=1 SV=1
3	O44548	0.003	44.3	877	0.024	0.031	KNL2_CAEEL Kinetochore null protein 2 OS=Caenorhabditis elegans OX=6239 GN=knl-2 PE=1 SV=2
4	Q9SIJ5	0.057	37.0	101	0.014	0.158	RADL2_ARATH Protein RADIALIS-like 2 OS=Arabidopsis thaliana OX=3702 GN=RL2 PE=2 SV=1
5	Q1G3C4	0.18	34.7	77	0.013	0.195	RADL4_ARATH Protein RADIALIS-like 4 OS=Arabidopsis thaliana OX=3702 GN=RL4 PE=2 SV=1
6	Q58FS3	0.26	34.7	93	0.015	0.183	RAD_ANTMA Transcription factor RADIALIS OS=Antirrhinum majus OX=4151 GN=RAD PE=1 SV=1
7	P54103	0.29	37.7	621	0.023	0.042	DNJC2_MOUSE DnaJ homolog subfamily C member 2 OS=Mus musculus OX=10090 GN=Dnajc2 PE=1 SV=2
8	P32591	1.2	35.8	825	0.014	0.019	SWI3_YEAST SWI/SNF complex subunit SWI3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SWI3 PE=1 SV=1
9	Q1A173	2.3	32.3	97	0.013	0.155	RADL6_ARATH Protein RADIALIS-like 6 OS=Arabidopsis thaliana OX=3702 GN=RL6 PE=2 SV=1
10	Q7TQ20	2.9	34.3	621	0.022	0.040	DNJC2_RAT DnaJ homolog subfamily C member 2 OS=Rattus norvegicus OX=10116 GN=Dnajc2 PE=1 SV=1
11	Q99543	5.9	33.5	621	0.022	0.040	DNJC2_HUMAN DnaJ homolog subfamily C member 2 OS=Homo sapiens OX=9606 GN=DNAJC2 PE=1 SV=4
12	O14147	6.6	33.1	844	0.010	0.013	CHL1_SCHPO ATP-dependent DNA helicase chl1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=chl1 PE=3 SV=1
13	Q9Y222	7.8	33.1	760	0.014	0.021	DMTF1_HUMAN Cyclin-D-binding Myb-like transcription factor 1 OS=Homo sapiens OX=9606 GN=DMTF1 PE=1 SV=1
14	F4KCE9	8.3	32.7	598	0.012	0.023	KNL2_ARATH Kinetochore-associated protein KNL-2 homolog OS=Arabidopsis thaliana OX=3702 GN=KNL2 PE=1 SV=1
15	E7EPA0	8.8	32.7	690	0.014	0.023	E7EPA0_HUMAN Cyclin D binding myb like transcription factor 1 OS=Homo sapiens OX=9606 GN=DMTF1 PE=1 SV=1
16	Q9ASQ2	9.7	32.3	309	0.012	0.045	MAMYB_ARATH Transcription factor MAMYB OS=Arabidopsis thaliana OX=3702 GN=MAMYB PE=1 SV=1
17	Q8CE22	10.0	32.7	761	0.014	0.021	DMTF1_MOUSE Cyclin-D-binding Myb-like transcription factor 1 OS=Mus musculus OX=10090 GN=Dmtf1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00249 Myb_DNA-binding	0.016	26.7	Myb-like DNA-binding domain
2	PF13921 Myb_DNA-bind_6	21	16.8	Myb-like DNA-binding domain
3	PF09133 SANTA	1.4e-22	91.2	SANTA (SANT Associated)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000309790

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000220514	0.999	Protein Mis18-beta
2	9606.ENSP00000290130	0.999	Protein Mis18-alpha
3	9606.ENSP00000414109	0.997	Holliday junction recognition protein
4	9606.ENSP00000273853	0.965	Centromere protein C
5	9606.ENSP00000336868	0.965	Histone H3-like centromeric protein A
6	9606.ENSP00000377007	0.955	Centromere protein N
7	9606.ENSP00000362018	0.952	Centromere protein I
8	9606.ENSP00000369424	0.941	Histone-binding protein RBBP7
9	9606.ENSP00000287598	0.929	Mitotic checkpoint serine/threonine-protein kinase BUB1 beta
10	9606.ENSP00000259021	0.916	Histone acetyltransferase KAT7
11	9606.ENSP00000302530	0.914	Mitotic checkpoint serine/threonine-protein kinase BUB1
12	9606.ENSP00000260731	0.906	Kinesin-like protein KIF11
13	9606.ENSP00000261597	0.904	Kinetochore protein NDC80 homolog
14	9606.ENSP00000323300	0.904	Sperm-associated antigen 5
15	9606.ENSP00000265148	0.902	Centromere-associated protein E
16	9606.ENSP00000404190	0.893	Rac GTPase-activating protein 1
17	9606.ENSP00000274026	0.892	Cyclin-A2
18	9606.ENSP00000355922	0.891	Centromere protein F
19	9606.ENSP00000356379	0.881	Abnormal spindle-like microcephaly-associated protein
20	9606.ENSP00000411532	0.880	DNA topoisomerase 2-alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.992	regulation of biological process
GO:0009987	0.980	cellular process
GO:0050794	0.978	regulation of cellular process
GO:0071840	0.846	cellular component organization or biogenesis
GO:0016043	0.822	cellular component organization
GO:0022402	0.821	cell cycle process
GO:0019222	0.655	regulation of metabolic process
GO:0051171	0.649	regulation of nitrogen compound metabolic process
GO:0080090	0.644	regulation of primary metabolic process
GO:0031323	0.633	regulation of cellular metabolic process
GO:0060255	0.562	regulation of macromolecule metabolic process
GO:0006996	0.503	organelle organization
GO:0048518	0.457	positive regulation of biological process
GO:0048522	0.434	positive regulation of cellular process
GO:0019219	0.431	regulation of nucleobase-containing compound metabolic process
GO:0007059	0.401	chromosome segregation
GO:0051726	0.394	regulation of cell cycle
GO:0044238	0.385	primary metabolic process
GO:0071704	0.380	organic substance metabolic process
GO:0010564	0.353	regulation of cell cycle process
GO:0006807	0.348	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.961	intracellular non-membrane-bounded organelle
GO:0005694	0.788	chromosome
GO:0005737	0.701	cytoplasm
GO:0005829	0.600	cytosol
GO:0032991	0.418	protein-containing complex
GO:0000793	0.366	condensed chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]