StarFunc result for job id Q6P0Q8

User Input

>input (1798 residues)
MKRSRCRDRPQPPPPDRREDGVQRAAELSQSLPPRRRAPPGRQRLEERTGPAGPEGKEQD
VVTGVSPLLFRKLSNPDIFSSTGKVKLQRQLSQDDCKLWRGNLASSLSGKQLLPLSSSVH
SSVGQVTWQSSGEASNLVRMRNQSLGQSAPSLTAGLKELSLPRRGSFCRTSNRKSLIVTS
STSPTLPRPHSPLHGHTGNSPLDSPRNFSPNAPAHFSFVPARRTDGRRWSLASLPSSGYG
TNTPSSTVSSSCSSQEKLHQLPFQPTADELHFLTKHFSTESVPDEEGRQSPAMRPRSRSL
SPGRSPVSFDSEIIMMNHVYKERFPKATAQMEERLAEFISSNTPDSVLPLADGALSFIHH
QVIEMARDCLDKSRSGLITSQYFYELQDNLEKLLQDAHERSESSEVAFVMQLVKKLMIII
ARPARLLECLEFDPEEFYHLLEAAEGHAKEGQGIKCDIPRYIVSQLGLTRDPLEEMAQLS
SCDSPDTPETDDSIEGHGASLPSKKTPSEEDFETIKLISNGAYGAVFLVRHKSTRQRFAM
KKINKQNLILRNQIQQAFVERDILTFAENPFVVSMFCSFDTKRHLCMVMEYVEGGDCATL
LKNIGALPVDMVRLYFAETVLALEYLHNYGIVHRDLKPDNLLITSMGHIKLTDFGLSKIG
LMSLTTNLYEGHIEKDAREFLDKQVCGTPEYIAPEVILRQGYGKPVDWWAMGIILYEFLV
GCVPFFGDTPEELFGQVISDEIVWPEGDEALPPDAQDLTSKLLHQNPLERLGTGSAYEVK
QHPFFTGLDWTGLLRQKAEFIPQLESEDDTSYFDTRSERYHHMDSEDEEEVSEDGCLEIR
QFSSCSPRFNKVYSSMERLSLLEERRTPPPTKRSLSEEKEDHSDGLAGLKGRDRSWVIGS
PEILRKRLSVSESSHTESDSSPPMTVRRRCSGLLDAPRFPEGPEEASSTLRRQPQEGIWV
LTPPSGEGVSGPVTEHSGEQRPKLDEEAVGRSSGSSPAMETRGRGTSQLAEGATAKAISD
LAVRRARHRLLSGDSTEKRTARPVNKVIKSASATALSLLIPSEHHTCSPLASPMSPHSQS
SNPSSRDSSPSRDFLPALGSMRPPIIIHRAGKKYGFTLRAIRVYMGDSDVYTVHHMVWHV
EDGGPASEAGLRQGDLITHVNGEPVHGLVHTEVVELILKSGNKVAISTTPLENTSIKVGP
ARKGSYKAKMARRSKRSRGKDGQESRKRSSLFRKITKQASLLHTSRSLSSLNRSLSSGES
GPGSPTHSHSLSPRSPTQGYRVTPDAVHSVGGNSSQSSSPSSSVPSSPAGSGHTRPSSLH
GLAPKLQRQYRSPRRKSAGSIPLSPLAHTPSPPPPTASPQRSPSPLSGHVAQAFPTKLHL
SPPLGRQLSRPKSAEPPRSPLLKRVQSAEKLAAALAASEKKLATSRKHSLDLPHSELKKE
LPPREVSPLEVVGARSVLSGKGALPGKGVLQPAPSRALGTLRQDRAERRESLQKQEAIRE
VDSSEDDTEEGPENSQGAQELSLAPHPEVSQSVAPKGAGESGEEDPFPSRDPRSLGPMVP
SLLTGITLGPPRMESPSGPHRRLGSPQAIEEAASSSSAGPNLGQSGATDPIPPEGCWKAQ
HLHTQALTALSPSTSGLTPTSSCSPPSSTSGKLSMWSWKSLIEGPDRASPSRKATMAGGL
ANLQDLENTTPAQPKNLSPREQGKTQPPSAPRLAHPSYEDPSQGWLWESECAQAVKEDPA
LSITQVPDASGDRRQDVPCRGCPLTQKSEPSLRRGQEPGGHQKHRDLALVPDELLKQT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q60592	0.405	0.419	0.000	1734	0.852	0.883	Q60592.pdb.gz	MAST2_MOUSE Microtubule-associated serine/threonine-protein kinase 2 OS=Mus musculus OX=10090 GN=Mast2 PE=1 SV=1
2	AFDB:Q6P0Q8	0.999	0.999	0.000	1798	1.000	1.000	Q6P0Q8.pdb.gz	MAST2_HUMAN Microtubule-associated serine/threonine-protein kinase 2 OS=Homo sapiens OX=9606 GN=MAST2 PE=1 SV=2
3	AFDB:Q9R1L5	0.393	0.445	0.000	1570	0.555	0.636	Q9R1L5.pdb.gz	MAST1_MOUSE Microtubule-associated serine/threonine-protein kinase 1 OS=Mus musculus OX=10090 GN=Mast1 PE=1 SV=3
4	AFDB:Q9VUQ9	0.221	0.189	4.603E-90	2139	0.377	0.317	Q9VUQ9.pdb.gz	Q9VUQ9_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=dop PE=1 SV=1
5	AFDB:F4J6F6	0.160	0.220	3.696E-27	1296	0.143	0.199	F4J6F6.pdb.gz	IREH1_ARATH Probable serine/threonine protein kinase IREH1 OS=Arabidopsis thaliana OX=3702 GN=IREH1 PE=1 SV=1
6	PDB:6byrA	0.159	0.685	4.703E-26	405	0.073	0.326	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
7	PDB:5x3fB	0.150	0.729	8.254E-24	349	0.069	0.355	5x3fB.pdb.gz
8	PDB:5dykA	0.152	0.334	4.547E-23	809	0.055	0.122	5dykA.pdb.gz
9	PDB:3c4wB	0.156	0.520	9.447E-23	519	0.066	0.229	3c4wB.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.
10	PDB:3pfqA	0.151	0.509	1.963E-22	523	0.056	0.193	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
11	PDB:3nynA	0.178	0.552	2.164E-22	554	0.071	0.231	3nynA.pdb.gz	Molecular basis for activation of G protein-coupled receptor kinases.
12	PDB:6pjxA	0.176	0.555	3.524E-22	543	0.073	0.243	6pjxA.pdb.gz	Structure of a GRK5-Calmodulin Complex Reveals Molecular Mechanism of GRK Activation and Substrate Targeting.
13	PDB:3pvuA	0.156	0.438	9.809E-22	609	0.067	0.199	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
14	AFDB:H2KYA5	0.151	0.151	1.437E-21	1793	0.160	0.160	H2KYA5.pdb.gz	H2KYA5_CAEEL Protein kinase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-82 PE=1 SV=1
15	PDB:4mk0A	0.169	0.455	3.318E-21	631	0.067	0.192	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
16	PDB:6s9wA	0.146	0.591	8.379E-21	411	0.066	0.290	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
17	AFDB:Q5A650	0.150	0.188	1.060E-20	1408	0.144	0.184	Q5A650.pdb.gz	Q5A650_CANAL Serine/threonine protein kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SAK1 PE=4 SV=1
18	AFDB:A1ZBC4	0.142	0.173	3.254E-20	1471	0.133	0.162	A1ZBC4.pdb.gz	A1ZBC4_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=Sik3 PE=3 SV=2
19	AFDB:P34244	0.155	0.180	3.218E-19	1518	0.144	0.171	P34244.pdb.gz	HSL1_YEAST Probable serine/threonine-protein kinase HSL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HSL1 PE=1 SV=2
20	AFDB:E7F2F9	0.135	0.148	1.200E-18	1634	0.143	0.158	E7F2F9.pdb.gz	E7F2F9_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=wnk1a PE=3 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60307	0.0	1093	1309	0.303	0.416	MAST3_HUMAN Microtubule-associated serine/threonine-protein kinase 3 OS=Homo sapiens OX=9606 GN=MAST3 PE=1 SV=2
2	Q60592	0.0	2844	1734	0.853	0.885	MAST2_MOUSE Microtubule-associated serine/threonine-protein kinase 2 OS=Mus musculus OX=10090 GN=Mast2 PE=1 SV=1
3	Q6P0Q8	0.0	3644	1798	1.000	1.000	MAST2_HUMAN Microtubule-associated serine/threonine-protein kinase 2 OS=Homo sapiens OX=9606 GN=MAST2 PE=1 SV=2
4	Q9R1L5	0.0	1696	1570	0.515	0.590	MAST1_MOUSE Microtubule-associated serine/threonine-protein kinase 1 OS=Mus musculus OX=10090 GN=Mast1 PE=1 SV=3
5	Q9Y2H9	0.0	1689	1570	0.512	0.587	MAST1_HUMAN Microtubule-associated serine/threonine-protein kinase 1 OS=Homo sapiens OX=9606 GN=MAST1 PE=1 SV=2
6	Q9VUQ9	1.45e-161	547	2139	0.138	0.116	Q9VUQ9_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=dop PE=1 SV=1
7	Q9LE81	2.45e-91	326	1168	0.088	0.136	IRE_ARATH Probable serine/threonine protein kinase IRE OS=Arabidopsis thaliana OX=3702 GN=IRE PE=2 SV=1
8	F4J6F6	1.74e-88	320	1296	0.091	0.126	IREH1_ARATH Probable serine/threonine protein kinase IREH1 OS=Arabidopsis thaliana OX=3702 GN=IREH1 PE=1 SV=1
9	F4HYG2	1.85e-86	312	1235	0.089	0.130	IRE3_ARATH Probable serine/threonine protein kinase IRE3 OS=Arabidopsis thaliana OX=3702 GN=IRE3 PE=2 SV=1
10	Q9LW66	2.92e-70	249	568	0.071	0.225	Q9LW66_ARATH AGC (cAMP-dependent, cGMP-dependent and protein kinase C) kinase family protein OS=Arabidopsis thaliana OX=3702 GN=At3g23310 PE=1 SV=1
11	Q8I4W3	7.65e-70	253	735	0.069	0.169	Q8I4W3_PLAF7 RAC-beta serine/threonine protein kinase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1246900 PE=4 SV=1
12	Q8UUX0	9.22e-68	239	479	0.074	0.278	Q8UUX0_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=cb945 PE=1 SV=1
13	P22694	1.98e-67	234	351	0.067	0.342	KAPCB_HUMAN cAMP-dependent protein kinase catalytic subunit beta OS=Homo sapiens OX=9606 GN=PRKACB PE=1 SV=2
14	P47197	2.24e-67	238	481	0.073	0.272	AKT2_RAT RAC-beta serine/threonine-protein kinase OS=Rattus norvegicus OX=10116 GN=Akt2 PE=1 SV=1
15	F1SD45	2.52e-67	234	351	0.067	0.345	F1SD45_PIG cAMP-dependent protein kinase OS=Sus scrofa OX=9823 GN=PRKACA PE=3 SV=1
16	P36887	2.57e-67	234	351	0.067	0.345	KAPCA_PIG cAMP-dependent protein kinase catalytic subunit alpha OS=Sus scrofa OX=9823 GN=PRKACA PE=1 SV=4
17	P68181	4.36e-67	233	351	0.068	0.348	KAPCB_MOUSE cAMP-dependent protein kinase catalytic subunit beta OS=Mus musculus OX=10090 GN=Prkacb PE=1 SV=2
18	P68182	4.36e-67	233	351	0.068	0.348	KAPCB_RAT cAMP-dependent protein kinase catalytic subunit beta OS=Rattus norvegicus OX=10116 GN=Prkacb PE=1 SV=2
19	G1SK25	4.83e-67	232	338	0.067	0.358	G1SK25_RABIT cAMP-dependent protein kinase OS=Oryctolagus cuniculus OX=9986 GN=PRKACB PE=3 SV=3
20	Q5AP53	8.77e-67	244	732	0.069	0.169	CBK1_CANAL Serine/threonine-protein kinase CBK1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CBK1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.39	21.3	ABC1 atypical kinase-like domain
2	PF01636 APH	0.81	21.0	Phosphotransferase enzyme family
3	PF08926 DUF1908	3.5e-134	457.8	Domain of unknown function (DUF1908)
4	PF12330 Haspin_kinase	4.7e+02	11.1	Haspin like kinase domain
5	PF14531 Kinase-like	6.4	17.6	Kinase-like
6	PF00595 PDZ	0.00027	32.6	PDZ domain
7	PF13180 PDZ_2	0.0038	28.9	PDZ domain
8	PF17820 PDZ_6	1.4e-05	36.2	PDZ domain
9	PF02163 Peptidase_M50	0.069	24.0	Peptidase family M50
10	PF00069 Pkinase	2.9e-58	208.9	Protein kinase domain
11	PF07714 PK_Tyr_Ser-Thr	8.9e-22	89.2	Protein tyrosine and serine/threonine kinase
12	PF01163 RIO1	3e+02	12.4	RIO1 family
13	PF14685 Tricorn_PDZ	3.2e+02	12.7	Tricorn protease PDZ domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354671

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361021	0.993	Phosphatase and tensin homolog
2	9606.ENSP00000433623	0.859	TNF receptor-associated factor 6
3	9606.ENSP00000346151	0.740	Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2
4	9606.ENSP00000361664	0.716	Transcription factor HIVEP3
5	9606.ENSP00000347224	0.713	Vasculin-like protein 1
6	9606.ENSP00000338191	0.701	Beta-2-syntrophin
7	9606.ENSP00000349594	0.680	ELAV-like protein 4
8	9606.ENSP00000263708	0.667	Tyrosine-protein phosphatase non-receptor type 4
9	9606.ENSP00000360560	0.652	T-complex-associated-testis-expressed 1
10	9606.ENSP00000361095	0.649	Transmembrane protein 69
11	9606.ENSP00000353769	0.648	Splicing factor, arginine/serine-rich 19
12	9606.ENSP00000312399	0.624	Coiled-coil domain-containing protein 63
13	9606.ENSP00000365619	0.622	Zinc finger protein 337
14	9606.ENSP00000262483	0.619	Membrane-associated phosphatidylinositol transfer protein 3
15	9606.ENSP00000424565	0.596	Cadherin-related family member 2
16	9606.ENSP00000358001	0.595	Transforming acidic coiled-coil-containing protein 2
17	9606.ENSP00000351015	0.589	Neurofibromin
18	9606.ENSP00000356990	0.561	Kelch domain containing 9
19	9606.ENSP00000337332	0.557	NAD-dependent protein deacetylase sirtuin-6
20	9606.ENSP00000455625	0.534	cAMP-regulated phosphoprotein 19

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019899	0.995	enzyme binding
GO:0140096	0.989	catalytic activity, acting on a protein
GO:0016301	0.987	kinase activity
GO:0016773	0.985	phosphotransferase activity, alcohol group as acceptor
GO:0004672	0.983	protein kinase activity
GO:0019902	0.978	phosphatase binding
GO:0004674	0.719	protein serine/threonine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.984	cellular process
GO:0065007	0.957	biological regulation
GO:0050789	0.953	regulation of biological process
GO:0032501	0.918	multicellular organismal process
GO:0032502	0.898	developmental process
GO:0071704	0.768	organic substance metabolic process
GO:0050794	0.762	regulation of cellular process
GO:0044238	0.754	primary metabolic process
GO:0006807	0.740	nitrogen compound metabolic process
GO:0043170	0.730	macromolecule metabolic process
GO:0044237	0.663	cellular metabolic process
GO:0036211	0.607	protein modification process
GO:0019222	0.536	regulation of metabolic process
GO:0060255	0.467	regulation of macromolecule metabolic process
GO:0048856	0.383	anatomical structure development
GO:0010468	0.375	regulation of gene expression
GO:0071840	0.355	cellular component organization or biogenesis
GO:0048522	0.331	positive regulation of cellular process
GO:0016043	0.327	cellular component organization
GO:0031323	0.304	regulation of cellular metabolic process
GO:0050896	0.301	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	1.000	intracellular anatomical structure
GO:0043229	0.989	intracellular organelle
GO:0043232	0.932	intracellular non-membrane-bounded organelle
GO:0005737	0.921	cytoplasm
GO:0016020	0.842	membrane
GO:0043227	0.836	membrane-bounded organelle
GO:0043231	0.650	intracellular membrane-bounded organelle
GO:0015630	0.646	microtubule cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.985	Phosphotransferases with an alcohol group as acceptor.

[back to server]