StarFunc result for job id Q6P158

User Input

>input (1386 residues)
MSSSVRRKGKPGKGGGKGSSRGGRGGRSHASKSHGSGGGGGGGGGGGGGNRKASSRIWDD
GDDFCIFSESRRPSRPSNSNISKGESRPKWKPKAKVPLQTLHMTSENQEKVKALLRDLQE
QDADAGSERGLSGEEEDDEPDCCNDERYWPAGQEPSLVPDLDPLEYAGLASVEPYVPEFT
VSPFAVQKLSRYGFNTERCQAVLRMCDGDVGASLEHLLTQCFSETFGERMKISEAVNQIS
LDECMEQRQEEAFALKSICGEKFIERIQNRVWTIGLELEYLTSRFRKSKPKESTKNVQEN
SLEICKFYLKGNCKFGSKCRFKHEVPPNQIVGRIERSVDDSHLNAIEDASFLYELEIRFS
KDHKYPYQAPLVAFYSTNENLPLACRLHISEFLYDKALTFAETSEPVVYSLITLLEEESE
IVKLLTNTHHKYSDPPVNFLPVPSRTRINNPACHKTVIPNNSFVSNQIPEVEKASESEES
DEDDGPAPVIVENESYVNLKKKISKRYDWQAKSVHAENGKICKQFRMKQASRQFQSILQE
RQSLPAWEERETILNLLRKHQVVVISGMTGCGKTTQIPQFILDDSLNGPPEKVANIICTQ
PRRISAISVAERVAKERAERVGLTVGYQIRLESVKSSATRLLYCTTGVLLRRLEGDTALQ
GVSHIIVDEVHERTEESDFLLLVLKDIVSQRPGLQVILMSATLNAELFSDYFNSCPVITI
PGRTFPVDQFFLEDAIAVTRYVLQDGSPYMRSMKQISKEKLKARRNRTAFEEVEEDLRLS
LHLQDQDSVKDAVPDQQLDFKQLLARYKGVSKSVIKTMSIMDFEKVNLELIEALLEWIVD
GKHSYPPGAILVFLPGLAEIKMLYEQLQSNSLFNNRRSNRCVIHPLHSSLSSEEQQAVFV
KPPAGVTKIIISTNIAETSITIDDVVYVIDSGKMKEKRYDASKGMESLEDTFVSQANALQ
RKGRAGRVASGVCFHLFTSHHYNHQLLKQQLPEIQRVPLEQLCLRIKILEMFSAHNLQSV
FSRLIEPPHTDSLRASKIRLRDLGALTPDERLTPLGYHLASLPVDVRIGKLMLFGSIFRC
LDPALTIAASLAFKSPFVSPWDKKEEANQKKLEFAFANSDYLALLQAYKGWQLSTKEGVR
ASYNYCRQNFLSGRVLQEMASLKRQFTELLSDIGFAREGLRAREIEKRAQGGDGVLDATG
EEANSNAENPKLISAMLCAALYPNVVQVKSPEGKFQKTSTGAVRMQPKSAELKFVTKNDG
YVHIHPSSVNYQVRHFDSPYLLYHEKIKTSRVFIRDCSMVSVYPLVLFGGGQVNVQLQRG
EFVVSLDDGWIRFVAASHQVAELVKELRCELDQLLQDKIKNPSIDLCTCPRGSRIISTIV
KLVTTQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6P158	1.000	1.000	0.000	1386	1.000	1.000	Q6P158.pdb.gz	DHX57_HUMAN Putative ATP-dependent RNA helicase DHX57 OS=Homo sapiens OX=9606 GN=DHX57 PE=1 SV=2
2	AFDB:F4ILR7	0.539	0.739	3.021E-76	995	0.255	0.356	F4ILR7.pdb.gz	DEXH1_ARATH DExH-box ATP-dependent RNA helicase DExH1 OS=Arabidopsis thaliana OX=3702 GN=At2g35920 PE=2 SV=1
3	AFDB:Q382X0	0.561	0.597	2.151E-75	1299	0.289	0.309	Q382X0.pdb.gz	Q382X0_TRYB2 RNA helicase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.3930 PE=4 SV=1
4	AFDB:Q05B79	0.506	0.679	1.363E-73	1010	0.274	0.376	Q05B79.pdb.gz	DHX36_BOVIN ATP-dependent DNA/RNA helicase DHX36 OS=Bos taurus OX=9913 GN=DHX36 PE=1 SV=1
5	AFDB:F4HYJ6	0.524	0.597	1.040E-68	1206	0.250	0.287	F4HYJ6.pdb.gz	F4HYJ6_ARATH RNA helicase OS=Arabidopsis thaliana OX=3702 GN=At1g48650 PE=1 SV=1
6	AFDB:O94536	0.531	0.553	1.382E-67	1327	0.250	0.261	O94536.pdb.gz	UCP12_SCHPO Putative ATP-dependent RNA helicase ucp12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ucp12 PE=3 SV=1
7	AFDB:Q8SWT2	0.534	0.773	4.772E-65	942	0.217	0.320	Q8SWT2.pdb.gz	Q8SWT2_DROME GH12763p OS=Drosophila melanogaster OX=7227 GN=Rhau PE=1 SV=1
8	PDB:5vheA	0.520	0.806	2.741E-63	871	0.264	0.420	5vheA.pdb.gz	Structural basis of G-quadruplex unfolding by the DEAH/RHA helicase DHX36.
9	AFDB:Q28141	0.527	0.566	7.987E-61	1287	0.253	0.273	Q28141.pdb.gz	DHX9_BOVIN ATP-dependent RNA helicase A OS=Bos taurus OX=9913 GN=DHX9 PE=1 SV=1
10	AFDB:O70133	0.523	0.525	1.426E-60	1380	0.220	0.221	O70133.pdb.gz	DHX9_MOUSE ATP-dependent RNA helicase A OS=Mus musculus OX=10090 GN=Dhx9 PE=1 SV=2
11	AFDB:B0S6Z1	0.530	0.576	5.946E-60	1271	0.253	0.275	B0S6Z1.pdb.gz
12	PDB:5n9dB	0.526	0.818	1.463E-58	866	0.222	0.356	5n9dB.pdb.gz	Molecular Mechanistic Insights into Drosophila DHX36-Mediated G-Quadruplex Unfolding: A Structure-Based Model.
13	PDB:5aorA	0.523	0.709	6.205E-57	1009	0.224	0.307	5aorA.pdb.gz	Structure of the RNA Helicase Mle Reveals the Molecular Mechanisms for Uridine Specificity and RNA-ATP Coupling.
14	PDB:6id1V	0.426	0.867	9.972E-45	663	0.168	0.351	6id1V.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
15	PDB:5xjcY	0.418	0.792	5.940E-44	713	0.165	0.320	5xjcY.pdb.gz	An Atomic Structure of the Human Spliceosome
16	PDB:5ylzW	0.416	0.800	3.936E-42	703	0.164	0.323	5ylzW.pdb.gz	Structure of the Post-catalytic Spliceosome from Saccharomyces cerevisiae
17	PDB:6ff7q	0.417	0.899	6.429E-42	625	0.165	0.366	6ff7q.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
18	PDB:7dcpx	0.408	0.817	8.785E-42	670	0.156	0.322	7dcpx.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.
19	PDB:3kx2B	0.417	0.748	9.605E-42	755	0.169	0.310	3kx2B.pdb.gz	Structural basis for the function of DEAH helicases
20	PDB:5wsge	0.392	0.750	3.467E-39	679	0.150	0.306	5wsge.pdb.gz	Structure of a yeast step II catalytically activated spliceosome

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D4A2Z8	0.0	630	1000	0.271	0.375	DHX36_RAT ATP-dependent DNA/RNA helicase DHX36 OS=Rattus norvegicus OX=10116 GN=Dhx36 PE=1 SV=1
2	E7EWK3	0.0	562	797	0.237	0.412	E7EWK3_HUMAN RNA helicase (Fragment) OS=Homo sapiens OX=9606 GN=DHX36 PE=1 SV=1
3	F4ILR7	0.0	631	995	0.259	0.361	DEXH1_ARATH DExH-box ATP-dependent RNA helicase DExH1 OS=Arabidopsis thaliana OX=3702 GN=At2g35920 PE=2 SV=1
4	Q05B79	0.0	644	1010	0.274	0.376	DHX36_BOVIN ATP-dependent DNA/RNA helicase DHX36 OS=Bos taurus OX=9913 GN=DHX36 PE=1 SV=1
5	Q6P158	0.0	2868	1386	1.000	1.000	DHX57_HUMAN Putative ATP-dependent RNA helicase DHX57 OS=Homo sapiens OX=9606 GN=DHX57 PE=1 SV=2
6	Q6PGC1	0.0	585	1365	0.249	0.253	DHX29_MOUSE ATP-dependent RNA helicase DHX29 OS=Mus musculus OX=10090 GN=Dhx29 PE=1 SV=1
7	Q7Z478	0.0	590	1369	0.249	0.252	DHX29_HUMAN ATP-dependent RNA helicase DHX29 OS=Homo sapiens OX=9606 GN=DHX29 PE=1 SV=2
8	Q8VHK9	0.0	633	1001	0.269	0.373	DHX36_MOUSE ATP-dependent DNA/RNA helicase DHX36 OS=Mus musculus OX=10090 GN=Dhx36 PE=1 SV=2
9	Q9H2U1	0.0	632	1008	0.269	0.370	DHX36_HUMAN ATP-dependent DNA/RNA helicase DHX36 OS=Homo sapiens OX=9606 GN=DHX36 PE=1 SV=2
10	F4HYJ6	5.33e-172	548	1206	0.240	0.275	F4HYJ6_ARATH RNA helicase OS=Arabidopsis thaliana OX=3702 GN=At1g48650 PE=1 SV=1
11	Q382X0	6.34e-165	531	1299	0.250	0.267	Q382X0_TRYB2 RNA helicase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.3930 PE=4 SV=1
12	Q8SWT2	2.66e-149	479	942	0.218	0.321	Q8SWT2_DROME GH12763p OS=Drosophila melanogaster OX=7227 GN=Rhau PE=1 SV=1
13	Q28141	2.86e-145	478	1287	0.224	0.241	DHX9_BOVIN ATP-dependent RNA helicase A OS=Bos taurus OX=9913 GN=DHX9 PE=1 SV=1
14	P24785	7.89e-145	477	1293	0.224	0.240	MLE_DROME Dosage compensation regulator OS=Drosophila melanogaster OX=7227 GN=mle PE=1 SV=2
15	Q08211	5.90e-144	474	1270	0.221	0.241	DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4
16	O70133	5.96e-137	457	1380	0.222	0.223	DHX9_MOUSE ATP-dependent RNA helicase A OS=Mus musculus OX=10090 GN=Dhx9 PE=1 SV=2
17	O60114	1.10e-121	415	1428	0.199	0.193	YG65_SCHPO Uncharacterized helicase C15C4.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC15C4.05 PE=3 SV=1
18	Q581T1	7.33e-112	392	2167	0.207	0.132	REH2_TRYB2 RNA editing associated helicase 2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=REH2 PE=1 SV=1
19	Q583S9	3.21e-106	368	1251	0.198	0.220	Q583S9_TRYB2 ATP-dependent DEAH-box RNA helicase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.3D8.660 PE=4 SV=1
20	Q06698	4.54e-105	368	1435	0.202	0.195	YL419_YEAST Putative ATP-dependent RNA helicase YLR419W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YLR419W PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13173 AAA_14	18	16.8	AAA domain
2	PF13245 AAA_19	22	16.7	AAA domain
3	PF13401 AAA_22	17	17.1	AAA domain
4	PF13476 AAA_23	1.2e+02	14.7	AAA domain
5	PF02456 Adeno_IVa2	65	13.8	Adenovirus IVa2 protein
6	PF01637 ATPase_2	61	15.0	ATPase domain predominantly from Archaea
7	PF02492 cobW	11	17.0	CobW/HypB/UreG, nucleotide-binding domain
8	PF00270 DEAD	1e-07	43.4	DEAD/DEAH box helicase
9	PF04408 HA2	4.6e-13	60.7	Helicase associated domain (HA2)
10	PF00271 Helicase_C	3.8e-11	54.7	Helicase conserved C-terminal domain
11	PF00931 NB-ARC	65	14.2	NB-ARC domain
12	PF07717 OB_NTP_bind	1.1e-17	75.5	Oligonucleotide/oligosaccharide-binding (OB)-fold
13	PF05773 RWD	8.1e-14	63.3	RWD domain
14	PF00437 T2SSE	47	14.5	Type II/IV secretion system protein
15	PF16131 Torus	0.039	26.0	Torus domain
16	PF01443 Viral_helicase1	2.9e+02	12.6	Viral (Superfamily 1) RNA helicase
17	PF00642 zf-CCCH	0.0022	29.1	Zinc finger C-x8-C-x5-C-x3-H type (and similar)
18	PF14608 zf-CCCH_2	0.78	21.6	RNA-binding, Nab2-type zinc finger
19	PF18044 zf-CCCH_4	0.00025	32.0	CCCH-type zinc finger
20	PF18345 zf_CCCH_4	0.075	24.3	Zinc finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000405111

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000281961	0.789	Transmembrane protein 178A
2	9606.ENSP00000456405	0.748	Target of rapamycin complex subunit LST8
3	9606.ENSP00000259711	0.716	Kinesin-like protein KIF13A
4	9606.ENSP00000346067	0.715	40S ribosomal protein SA
5	9606.ENSP00000365530	0.705	Syntaxin-binding protein 4
6	9606.ENSP00000367197	0.690	Secretagogin, EF-hand calcium binding protein
7	9606.ENSP00000382840	0.667	ATP-dependent RNA helicase DDX3X
8	9606.ENSP00000483254	0.662	Heterogeneous nuclear ribonucleoprotein D-like
9	9606.ENSP00000311219	0.645	Tripartite motif-containing protein 59
10	9606.ENSP00000305161	0.637	E3 ubiquitin-protein ligase TRIM56
11	9606.ENSP00000345464	0.630	E3 ubiquitin-protein ligase NHLRC1
12	9606.ENSP00000422626	0.615	La-related protein 7
13	9606.ENSP00000323858	0.602	ATP-dependent RNA helicase DDX54
14	9606.ENSP00000340329	0.597	Caprin-1
15	9606.ENSP00000363590	0.586	Chondroitin sulfate N-acetylgalactosaminyltransferase 2
16	9606.ENSP00000224140	0.579	Probable helicase senataxin
17	9606.ENSP00000377944	0.574	U3 small nucleolar RNA-associated protein 14 homolog A
18	9606.ENSP00000247003	0.567	Probable ATP-dependent RNA helicase DDX49
19	9606.ENSP00000258729	0.566	Insulin-like growth factor 2 mRNA-binding protein 3
20	9606.ENSP00000457411	0.564	Ubiquitin carboxyl-terminal hydrolase 10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0003723	0.998	RNA binding
GO:0003824	0.856	catalytic activity
GO:0140098	0.669	catalytic activity, acting on RNA
GO:0043021	0.337	ribonucleoprotein complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0071704	0.979	organic substance metabolic process
GO:0043170	0.942	macromolecule metabolic process
GO:0044238	0.921	primary metabolic process
GO:0050789	0.909	regulation of biological process
GO:0044237	0.908	cellular metabolic process
GO:0006807	0.890	nitrogen compound metabolic process
GO:0034641	0.771	cellular nitrogen compound metabolic process
GO:0050794	0.705	regulation of cellular process
GO:0071840	0.670	cellular component organization or biogenesis
GO:0010467	0.666	gene expression
GO:1901360	0.637	organic cyclic compound metabolic process
GO:0090304	0.632	nucleic acid metabolic process
GO:0019222	0.602	regulation of metabolic process
GO:0016070	0.572	RNA metabolic process
GO:0060255	0.480	regulation of macromolecule metabolic process
GO:0031323	0.417	regulation of cellular metabolic process
GO:0006396	0.384	RNA processing
GO:0080090	0.344	regulation of primary metabolic process
GO:0051171	0.344	regulation of nitrogen compound metabolic process
GO:0010468	0.326	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043229	0.982	intracellular organelle
GO:0043231	0.944	intracellular membrane-bounded organelle
GO:0005829	0.895	cytosol
GO:0043232	0.891	intracellular non-membrane-bounded organelle
GO:0070013	0.852	intracellular organelle lumen
GO:0032991	0.851	protein-containing complex
GO:0005634	0.481	nucleus
GO:0031981	0.453	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]