StarFunc result for job id Q6P1A2

User Input

>input (487 residues)
MASSAEGDEGTVVALAGVLQSGFQELSLNKLATSLGASEQALRLIISIFLGYPFALFYRH
YLFYKETYLIHLFHTFTGLSIAYFNFGNQLYHSLLCIVLQFLILRLMGRTITAVLTTFCF
QMAYLLAGYYYTATGNYDIKWTMPHCVLTLKLIGLAVDYFDGGKDQNSLSSEQQKYAIRG
VPSLLEVAGFSYFYGAFLVGPQFSMNHYMKLVQGELIDIPGKIPNSIIPALKRLSLGLFY
LVGYTLLSPHITEDYLLTEDYDNHPFWFRCMYMLIWGKFVLYKYVTCWLVTEGVCILTGL
GFNGFEEKGKAKWDACANMKVWLFETNPRFTGTIASFNINTNAWVARYIFKRLKFLGNKE
LSQGLSLLFLALWHGLHSGYLVCFQMEFLIVIVERQAARLIQESPTLSKLAAITVLQPFY
YLVQQTIHWLFMGYSMTAFCLFTWDKWLKVYKSIYFLGHIFFLSLLFILPYIHKAMVPRK
EKLKKME

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6P1A2	1.000	1.000	6.503E-66	487	1.000	1.000	Q6P1A2.pdb.gz	MBOA5_HUMAN Lysophospholipid acyltransferase 5 OS=Homo sapiens OX=9606 GN=LPCAT3 PE=1 SV=1
2	AFDB:Q91V01	0.963	0.963	4.389E-60	487	0.873	0.873	Q91V01.pdb.gz	MBOA5_MOUSE Lysophospholipid acyltransferase 5 OS=Mus musculus OX=10090 GN=Lpcat3 PE=1 SV=1
3	AFDB:O01925	0.904	0.930	4.217E-31	473	0.312	0.321	O01925.pdb.gz	MBOA5_CAEEL Lysophospholipid acyltransferase 5 OS=Caenorhabditis elegans OX=6239 GN=mboa-6 PE=1 SV=2
4	AFDB:Q9VVX5	0.893	0.876	1.360E-30	497	0.335	0.328	Q9VVX5.pdb.gz	MBOA5_DROME Lysophospholipid acyltransferase 5 OS=Drosophila melanogaster OX=7227 GN=nes PE=1 SV=1
5	AFDB:O42916	0.830	0.796	2.603E-23	509	0.232	0.222	O42916.pdb.gz	ALE1_SCHPO Lysophospholipid acyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ale1 PE=1 SV=1
6	AFDB:A0A1D8PHX1	0.867	0.708	8.026E-22	602	0.238	0.193	A0A1D8PHX1.pdb.gz	A0A1D8PHX1_CANAL Lysophospholipid acyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=LPT1 PE=4 SV=1
7	AFDB:Q9CAN8	0.836	0.874	1.076E-21	465	0.228	0.239	Q9CAN8.pdb.gz	MBOA2_ARATH Lysophospholipid acyltransferase 2 OS=Arabidopsis thaliana OX=3702 GN=LPCAT2 PE=1 SV=1
8	AFDB:F4IDU4	0.828	0.871	2.100E-21	462	0.228	0.240	F4IDU4.pdb.gz	MBOA1_ARATH Lysophospholipid acyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=LPCAT1 PE=1 SV=1
9	AFDB:Q6ZWT7	0.802	0.754	3.771E-21	520	0.214	0.200	Q6ZWT7.pdb.gz	MBOA2_HUMAN Lysophospholipid acyltransferase 2 OS=Homo sapiens OX=9606 GN=MBOAT2 PE=1 SV=2
10	AFDB:Q8BH98	0.824	0.816	4.457E-21	492	0.214	0.211	Q8BH98.pdb.gz	MBOA1_MOUSE Lysophospholipid acyltransferase 1 OS=Mus musculus OX=10090 GN=Mboat1 PE=1 SV=1
11	PDB:7uraA	0.685	0.766	1.641E-12	432	0.191	0.215	7uraA.pdb.gz	Mechanisms and inhibition of Porcupine-mediated Wnt acylation.
12	PDB:7mhyA	0.567	0.563	1.913E-7	491	0.144	0.143	7mhyA.pdb.gz	Substrate and product complexes reveal mechanisms of Hedgehog acylation by HHAT.
13	PDB:6vz1A	0.408	0.470	3.541E-3	411	0.107	0.127	6vz1A.pdb.gz	Structure and catalytic mechanism of a human triacylglycerol-synthesis enzyme.
14	PDB:7n6qA	0.294	0.360	6.630E-3	375	0.107	0.139	7n6qA.pdb.gz	Structure of PPPA bound human ACAT2
15	PDB:6vumA	0.373	0.429	4.538E-2	409	0.103	0.122	6vumA.pdb.gz	Structure of nevanimibe-bound tetrameric human ACAT1.
16	PDB:5ykeB	0.110	0.074	4.525E-1	845	0.129	0.075	5ykeB.pdb.gz	Ligand binding and conformational changes of SUR1 subunit in pancreatic ATP-sensitive potassium channels.
17	PDB:7p5jA	0.083	0.099	8.834E-1	399	0.131	0.160	7p5jA.pdb.gz
18	PDB:5k3hB	0.097	0.085	9.212E-1	635	0.097	0.074	5k3hB.pdb.gz
19	PDB:7w2zR	0.127	0.174	1.044	301	0.074	0.120	7w2zR.pdb.gz	Molecular mechanism of agonism and inverse agonism in ghrelin receptor.
20	PDB:7jm7A	0.108	0.092	1.399	683	0.107	0.076	7jm7A.pdb.gz	Cryo-EM structure of the lysosomal chloride-proton exchanger CLC-7 in complex with OSTM1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6P1A2	0.0	1000	487	1.000	1.000	MBOA5_HUMAN Lysophospholipid acyltransferase 5 OS=Homo sapiens OX=9606 GN=LPCAT3 PE=1 SV=1
2	Q91V01	0.0	895	487	0.873	0.873	MBOA5_MOUSE Lysophospholipid acyltransferase 5 OS=Mus musculus OX=10090 GN=Lpcat3 PE=1 SV=1
3	Q9VVX5	1.19e-104	323	497	0.341	0.334	MBOA5_DROME Lysophospholipid acyltransferase 5 OS=Drosophila melanogaster OX=7227 GN=nes PE=1 SV=1
4	O01925	1.74e-92	291	473	0.322	0.332	MBOA5_CAEEL Lysophospholipid acyltransferase 5 OS=Caenorhabditis elegans OX=6239 GN=mboa-6 PE=1 SV=2
5	A0A1D8PHX1	6.01e-38	148	602	0.234	0.189	A0A1D8PHX1_CANAL Lysophospholipid acyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=LPT1 PE=4 SV=1
6	O42916	9.42e-36	141	509	0.238	0.228	ALE1_SCHPO Lysophospholipid acyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ale1 PE=1 SV=1
7	Q6NN55	1.22e-34	140	722	0.248	0.168	MBOA6_DROME Lysophospholipid acyltransferase 6 OS=Drosophila melanogaster OX=7227 GN=oys PE=1 SV=1
8	Q08548	4.74e-34	137	619	0.230	0.181	ALE1_YEAST Lysophospholipid acyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALE1 PE=1 SV=1
9	Q9CAN8	5.65e-30	124	465	0.253	0.265	MBOA2_ARATH Lysophospholipid acyltransferase 2 OS=Arabidopsis thaliana OX=3702 GN=LPCAT2 PE=1 SV=1
10	F4IDU4	5.64e-28	118	462	0.251	0.264	MBOA1_ARATH Lysophospholipid acyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=LPCAT1 PE=1 SV=1
11	Q8R3I2	2.19e-26	114	519	0.230	0.216	MBOA2_MOUSE Lysophospholipid acyltransferase 2 OS=Mus musculus OX=10090 GN=Mboat2 PE=1 SV=1
12	Q6ZWT7	2.22e-26	114	520	0.224	0.210	MBOA2_HUMAN Lysophospholipid acyltransferase 2 OS=Homo sapiens OX=9606 GN=MBOAT2 PE=1 SV=2
13	Q8BH98	2.71e-23	104	492	0.224	0.222	MBOA1_MOUSE Lysophospholipid acyltransferase 1 OS=Mus musculus OX=10090 GN=Mboat1 PE=1 SV=1
14	Q8T8Q2	6.38e-21	97.4	451	0.115	0.124	Q8T8Q2_DROME SD07362p OS=Drosophila melanogaster OX=7227 GN=oys PE=2 SV=1
15	Q6ZNC8	2.16e-19	93.2	495	0.236	0.232	MBOA1_HUMAN Lysophospholipid acyltransferase 1 OS=Homo sapiens OX=9606 GN=MBOAT1 PE=1 SV=1
16	Q19468	1.13e-11	68.9	453	0.199	0.214	MBOA7_CAEEL Lysophospholipid acyltransferase 7 OS=Caenorhabditis elegans OX=6239 GN=mboa-7 PE=1 SV=2
17	Q9VMD5	1.56e-09	62.4	489	0.203	0.202	MBOA7_DROME Lysophospholipid acyltransferase 7 OS=Drosophila melanogaster OX=7227 GN=frj PE=1 SV=1
18	Q96N66	3.23e-08	58.2	472	0.152	0.157	MBOA7_HUMAN Lysophospholipid acyltransferase 7 OS=Homo sapiens OX=9606 GN=MBOAT7 PE=1 SV=2
19	Q8CHK3	8.65e-08	57.0	473	0.144	0.148	MBOA7_MOUSE Lysophospholipid acyltransferase 7 OS=Mus musculus OX=10090 GN=Mboat7 PE=1 SV=1
20	B1Q006	1.28e-05	49.7	415	0.109	0.128	MBOA4_DANRE Ghrelin O-acyltransferase OS=Danio rerio OX=7955 GN=mboat4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18903 DUF5659	1.2e+02	13.9	Domain of unknown function (DUF5659)
2	PF03062 MBOAT	1.7e-69	246.5	MBOAT, membrane-bound O-acyltransferase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261407

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000283415	0.965	Lysophosphatidylcholine acyltransferase 1
2	9606.ENSP00000262134	0.955	Lysophosphatidylcholine acyltransferase 2
3	9606.ENSP00000441980	0.955	Choline/ethanolaminephosphotransferase 1
4	9606.ENSP00000229266	0.953	Cholinephosphotransferase 1
5	9606.ENSP00000260585	0.946	Ethanolaminephosphotransferase 1
6	9606.ENSP00000482571	0.940	Glycerol-3-phosphate acyltransferase 3
7	9606.ENSP00000380184	0.939	Glycerol-3-phosphate acyltransferase 4
8	9606.ENSP00000255389	0.938	Phosphatidylethanolamine N-methyltransferase
9	9606.ENSP00000265276	0.937	Glycerol-3-phosphate acyltransferase 1, mitochondrial
10	9606.ENSP00000264775	0.935	Phospholipid phosphatase 1
11	9606.ENSP00000371586	0.932	Phosphatidylserine decarboxylase proenzyme, mitochondrial
12	9606.ENSP00000360296	0.927	Phospholipid phosphatase 3
13	9606.ENSP00000389395	0.926	Glycerol-3-phosphate acyltransferase 2, mitochondrial
14	9606.ENSP00000308258	0.922	Phosphatidylserine synthase 2
15	9606.ENSP00000317300	0.919	Lysophospholipid acyltransferase LPCAT4
16	9606.ENSP00000273371	0.917	Phospholipase A1 member A
17	9606.ENSP00000320337	0.916	HRAS-like suppressor 3
18	9606.ENSP00000329697	0.914	Phospholipid phosphatase 2
19	9606.ENSP00000419879	0.913	Phosphatidate cytidylyltransferase 2
20	9606.ENSP00000295887	0.911	Phosphatidate cytidylyltransferase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0071617	1.000	lysophospholipid acyltransferase activity
GO:0008374	1.000	O-acyltransferase activity
GO:0016411	0.993	acylglycerol O-acyltransferase activity
GO:0047184	0.988	1-acylglycerophosphocholine O-acyltransferase activity
GO:0106262	0.980	1-acylglycerophosphoethanolamine O-acyltransferase activity
GO:0003841	0.974	1-acylglycerol-3-phosphate O-acyltransferase activity
GO:0106263	0.955	1-acylglycerophosphoserine O-acyltransferase activity
GO:0005488	0.482	binding
GO:0005515	0.451	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006575	0.988	cellular modified amino acid metabolic process
GO:0006644	0.985	phospholipid metabolic process
GO:0046470	0.984	phosphatidylcholine metabolic process
GO:0065007	0.414	biological regulation
GO:0050789	0.353	regulation of biological process
GO:1901576	0.315	organic substance biosynthetic process
GO:0008610	0.308	lipid biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005789	1.000	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.3.1.-	1.000	Transferring groups other than amino-acyl groups.
RHEA:12937	0.988	a 1-acyl-sn-glycero-3-phosphocholine + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphocholine + CoA
EC:2.3.1.23	0.988	1-acylglycerophosphocholine O-acyltransferase.
RHEA:32995	0.980	a 1-acyl-sn-glycero-3-phosphoethanolamine + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphoethanolamine + CoA
RHEA:19709	0.974	a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA
EC:2.3.1.51	0.974	1-acylglycerol-3-phosphate O-acyltransferase.
RHEA:33191	0.955	a 1-acyl-sn-glycero-3-phospho-L-serine + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phospho-L-serine + CoA

[back to server]