StarFunc result for job id Q6P1J6

User Input

>input (1458 residues)
MGLRPGIFLLELLLLLGQGTPQIHTSPRKSTLEGQLWPETLKNSPFPCNPNKLGVNMPSK
SVHSLKPSDIKFVAAIGNLEIPPDPGTGDLEKQDWTERPQQVCMGVMTVLSDIIRYFSPS
VPMPVCHTGKRVIPHDGAEDLWIQAQELVRNMKENLQLDFQFDWKLINVFFSNASQCYLC
PSAQQNGLAAGGVDELMGVLDYLQQEVPRAFVNLVDLSEVAEVSRQYHGTWLSPAPEPCN
CSEETTRLAKVVMQWSYQEAWNSLLASSRYSEQESFTVVFQPFFYETTPSLHSEDPRLQD
STTLAWHLWNRMMEPAGEKDEPLSVKHGRPMKCPSQESPYLFSYRNSNYLTRLQKPQDKL
EVREGAEIRCPDKDPSDTVPTSVHRLKPADINVIGALGDSLTAGNGAGSTPGNVLDVLTQ
YRGLSWSVGGDENIGTVTTLANILREFNPSLKGFSVGTGKETSPNAFLNQAVAGGRAEDL
PVQARRLVDLMKNDTRIHFQEDWKIITLFIGGNDLCDFCNDLVHYSPQNFTDNIGKALDI
LHAEVPRAFVNLVTVLEIVNLRELYQEKKVYCPRMILRSLCPCVLKFDDNSTELATLIEF
NKKFQEKTHQLIESGRYDTREDFTVVVQPFFENVDMPKTSEGLPDNSFFAPDCFHFSSKS
HSRAASALWNNMLEPVGQKTTRHKFENKINITCPNQVQPFLRTYKNSMQGHGTWLPCRDR
APSALHPTSVHALRPADIQVVAALGDSLTAGNGIGSKPDDLPDVTTQYRGLSYSAGGDGS
LENVTTLPNILREFNRNLTGYAVGTGDANDTNAFLNQAVPGAKAEDLMSQVQTLMQKMKD
DHRVNFHEDWKVITVLIGGSDLCDYCTDSNLYSAANFVHHLRNALDVLHREVPRVLVNLV
DFLNPTIMRQVFLGNPDKCPVQQASVLCNCVLTLRENSQELARLEAFSRAYRSSMRELVG
SGRYDTQEDFSVVLQPFFQNIQLPVLADGLPDTSFFAPDCIHPNQKFHSQLARALWTNML
EPLGSKTETLDLRAEMPITCPTQNEPFLRTPRNSNYTYPIKPAIENWGSDFLCTEWKASN
SVPTSVHQLRPADIKVVAALGDSLTTAVGARPNNSSDLPTSWRGLSWSIGGDGNLETHTT
LPNILKKFNPYLLGFSTSTWEGTAGLNVAAEGARARDMPAQAWDLVERMKNSPDINLEKD
WKLVTLFIGVNDLCHYCENPEAHLATEYVQHIQQALDILSEELPRAFVNVVEVMELASLY
QGQGGKCAMLAAQNNCTCLRHSQSSLEKQELKKVNWNLQHGISSFSYWHQYTQREDFAVV
VQPFFQNTLTPLNERGDTDLTFFSEDCFHFSDRGHAEMAIALWNNMLEPVGRKTTSNNFT
HSRAKLKCPSPESPYLYTLRNSRLLPDQAEEAPEVLYWAVPVAAGVGLVVGIIGTVVWRC
RRGGRREDPPMSLRTVAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O54728	0.677	0.680	0.000	1450	0.693	0.697	O54728.pdb.gz	PLB1_RAT Phospholipase B1, membrane-associated OS=Rattus norvegicus OX=10116 GN=Plb1 PE=1 SV=1
2	AFDB:Q05017	0.838	0.838	0.000	1458	0.772	0.772	Q05017.pdb.gz	PLB1_RABIT Phospholipase B1, membrane-associated OS=Oryctolagus cuniculus OX=9986 GN=PLB1 PE=1 SV=1
3	AFDB:Q3TTY0	0.499	0.493	0.000	1478	0.688	0.679	Q3TTY0.pdb.gz	PLB1_MOUSE Phospholipase B1, membrane-associated OS=Mus musculus OX=10090 GN=Plb1 PE=1 SV=2
4	AFDB:Q6P1J6	1.000	1.000	0.000	1458	1.000	1.000	Q6P1J6.pdb.gz	PLB1_HUMAN Phospholipase B1, membrane-associated OS=Homo sapiens OX=9606 GN=PLB1 PE=1 SV=3
5	AFDB:Q86B07	0.135	0.325	5.277E-7	564	0.038	0.099	Q86B07.pdb.gz	Q86B07_DICDI Saposin B-type domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0272785 PE=4 SV=1
6	PDB:5w7dA	0.134	0.336	9.678E-7	528	0.038	0.106	5w7dA.pdb.gz	Crystal structure of the mammalian lipopolysaccharide detoxifier.
7	AFDB:Q9C857	0.128	0.371	2.997E-5	394	0.034	0.127	Q9C857.pdb.gz	GDL16_ARATH GDSL esterase/lipase At1g31550 OS=Arabidopsis thaliana OX=3702 GN=At1g31550 PE=2 SV=1
8	AFDB:Q9HUP2	0.121	0.480	4.073E-5	307	0.035	0.166	Q9HUP2.pdb.gz	Q9HUP2_PSEAE ChoE OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=choE PE=1 SV=1
9	PDB:5malA	0.112	0.528	9.167E-5	234	0.032	0.201	5malA.pdb.gz
10	PDB:6uqvA	0.119	0.505	1.069E-4	287	0.029	0.150	6uqvA.pdb.gz
11	PDB:3milA	0.118	0.543	1.529E-4	240	0.029	0.179	3milA.pdb.gz
12	PDB:3kvnX	0.129	0.270	2.549E-4	628	0.032	0.075	3kvnX.pdb.gz	Crystal structure of a full-length autotransporter.
13	AFDB:Q9FXJ2	0.112	0.333	2.843E-4	390	0.032	0.118	Q9FXJ2.pdb.gz	GDL7_ARATH GDSL esterase/lipase At1g28580 OS=Arabidopsis thaliana OX=3702 GN=At1g28580 PE=2 SV=1
14	PDB:7e16A	0.112	0.654	3.127E-4	207	0.032	0.227	7e16A.pdb.gz
15	AFDB:Q9FIA1	0.141	0.446	1.190E-3	376	0.039	0.152	Q9FIA1.pdb.gz	GDL87_ARATH GDSL esterase/lipase At5g55050 OS=Arabidopsis thaliana OX=3702 GN=At5g55050 PE=2 SV=1
16	PDB:3dt9A	0.095	0.511	1.450E-3	212	0.028	0.193	3dt9A.pdb.gz	Crystal structures of brain group-VIII phospholipase A2 in nonaged complexes with the organophosphorus nerve agents soman and sarin.
17	PDB:3w7vA	0.077	0.415	2.298E-3	219	0.019	0.128	3w7vA.pdb.gz
18	AFDB:P42969	0.105	0.599	2.988E-3	213	0.026	0.178	P42969.pdb.gz	LIPC_BACSU Spore germination lipase LipC OS=Bacillus subtilis (strain 168) OX=224308 GN=lipC PE=2 SV=1
19	PDB:5tifA	0.098	0.646	4.466E-3	182	0.025	0.203	5tifA.pdb.gz	Computational Redesign of Acyl-ACP Thioesterase with Improved Selectivity toward Medium-Chain-Length Fatty Acids.
20	PDB:1vyhA	0.091	0.457	1.065E-2	218	0.027	0.179	1vyhA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O54728	0.0	2073	1450	0.687	0.690	PLB1_RAT Phospholipase B1, membrane-associated OS=Rattus norvegicus OX=10116 GN=Plb1 PE=1 SV=1
2	Q05017	0.0	2312	1458	0.774	0.774	PLB1_RABIT Phospholipase B1, membrane-associated OS=Oryctolagus cuniculus OX=9986 GN=PLB1 PE=1 SV=1
3	Q3TTY0	0.0	2051	1478	0.682	0.673	PLB1_MOUSE Phospholipase B1, membrane-associated OS=Mus musculus OX=10090 GN=Plb1 PE=1 SV=2
4	Q6P1J6	0.0	3042	1458	1.000	1.000	PLB1_HUMAN Phospholipase B1, membrane-associated OS=Homo sapiens OX=9606 GN=PLB1 PE=1 SV=3
5	E7FF48	0.92	36.6	2315	0.016	0.010	E7FF48_DANRE Nuclear receptor corepressor 2 OS=Danio rerio OX=7955 GN=SMRT PE=1 SV=2
6	Q8I4P3	1.0	35.8	379	0.016	0.061	Q8I4P3_PLAF7 Rifin OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1254400 PE=4 SV=1
7	Q8L5R3	1.6	35.8	1254	0.016	0.019	TBCD_ARATH Tubulin-folding cofactor D OS=Arabidopsis thaliana OX=3702 GN=TFCD PE=2 SV=1
8	Q6PAV2	3.9	34.7	1057	0.012	0.017	HERC4_MOUSE Probable E3 ubiquitin-protein ligase HERC4 OS=Mus musculus OX=10090 GN=Herc4 PE=1 SV=2
9	O04716	4.6	34.3	1324	0.026	0.029	MSH6_ARATH DNA mismatch repair protein MSH6 OS=Arabidopsis thaliana OX=3702 GN=MSH6 PE=1 SV=2
10	P38967	5.2	33.9	592	0.021	0.051	TAT2_YEAST Tryptophan permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TAT2 PE=1 SV=1
11	B1Q3J6	5.3	34.3	1529	0.011	0.010	DNM1B_ORYSJ DNA (cytosine-5)-methyltransferase 1B OS=Oryza sativa subsp. japonica OX=39947 GN=MET1B PE=2 SV=1
12	Q5GLZ8	5.3	33.9	1057	0.012	0.017	HERC4_HUMAN Probable E3 ubiquitin-protein ligase HERC4 OS=Homo sapiens OX=9606 GN=HERC4 PE=1 SV=1
13	Q9ZVA2	6.9	33.5	455	0.018	0.057	EP1L2_ARATH EP1-like glycoprotein 2 OS=Arabidopsis thaliana OX=3702 GN=At1g78830 PE=1 SV=1
14	Q4WV46	7.4	33.1	371	0.019	0.073	Q4WV46_ASPFU UDP-glucose 4-epimerase OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_5G10780 PE=3 SV=1
15	F4IL68	8.5	33.5	1198	0.014	0.017	F4IL68_ARATH SH3 domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=TASH3 PE=1 SV=1
16	Q84R15	8.6	33.5	1196	0.014	0.017	Q84R15_ARATH SH3 domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=TASH3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00657 Lipase_GDSL	9.5e-92	318.8	GDSL-like Lipase/Acylhydrolase
2	PF13472 Lipase_GDSL_2	1.6e-18	79.3	GDSL-like Lipase/Acylhydrolase family
3	PF17949 PND	76	15.0	FANCM pseudonuclease domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000330442

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000320337	0.930	HRAS-like suppressor 3
2	9606.ENSP00000264005	0.919	Phosphatidylcholine-sterol acyltransferase
3	9606.ENSP00000368305	0.900	Glycerophosphocholine phosphodiesterase GPCPD1
4	9606.ENSP00000320043	0.872	Acyl-protein thioesterase 1
5	9606.ENSP00000384610	0.845	Patatin-like phospholipase domain-containing protein 7
6	9606.ENSP00000219345	0.843	Group XV phospholipase A2
7	9606.ENSP00000364257	0.835	Group IIE secretory phospholipase A2
8	9606.ENSP00000363638	0.834	Acyl-protein thioesterase 2
9	9606.ENSP00000407509	0.834	Neuropathy target esterase
10	9606.ENSP00000389813	0.784	Acyl-CoA dehydrogenase family member 10
11	9606.ENSP00000215885	0.769	Group 3 secretory phospholipase A2
12	9606.ENSP00000472546	0.769	Cytosolic phospholipase A2 gamma
13	9606.ENSP00000333142	0.765	85/88 kDa calcium-independent phospholipase A2
14	9606.ENSP00000312286	0.761	Phospholipase A2
15	9606.ENSP00000324944	0.759	Lysophospholipid acyltransferase 1
16	9606.ENSP00000290472	0.758	Cytosolic phospholipase A2 delta
17	9606.ENSP00000243501	0.743	Group XIIA secretory phospholipase A2
18	9606.ENSP00000441980	0.743	Choline/ethanolaminephosphotransferase 1
19	9606.ENSP00000356436	0.736	Cytosolic phospholipase A2
20	9606.ENSP00000380442	0.733	Cytosolic phospholipase A2 zeta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0050253	1.000	retinyl-palmitate esterase activity
GO:0004623	1.000	phospholipase A2 activity
GO:0005515	0.997	protein binding
GO:0047499	0.929	calcium-independent phospholipase A2 activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044255	0.995	cellular lipid metabolic process
GO:0019637	0.985	organophosphate metabolic process
GO:0046486	0.985	glycerolipid metabolic process
GO:0006807	0.984	nitrogen compound metabolic process
GO:0046470	0.972	phosphatidylcholine metabolic process
GO:0016101	0.894	diterpenoid metabolic process
GO:0001523	0.876	retinoid metabolic process
GO:0065007	0.507	biological regulation
GO:0044281	0.436	small molecule metabolic process
GO:0016042	0.436	lipid catabolic process
GO:0050789	0.375	regulation of biological process
GO:0044242	0.311	cellular lipid catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043227	0.577	membrane-bounded organelle
GO:0005737	0.520	cytoplasm
GO:0012505	0.511	endomembrane system
GO:0043231	0.495	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:21508	1.000	all-trans-retinyl hexadecanoate + H2O = H(+) + hexadecanoate + retinol
EC:3.1.1.21	1.000	Deleted entry.
RHEA:15801	1.000	a 1,2-diacyl-sn-glycero-3-phosphocholine + H2O = a 1-acyl-sn-glycero-3-phosphocholine + a fatty acid + H(+)
EC:3.1.1.4	1.000	phospholipase A2.

[back to server]