StarFunc result for job id Q6P1J9

User Input

>input (531 residues)
MADVLSVLRQYNIQKKEIVVKGDEVIFGEFSWPKNVKTNYVVWGTGKEGQPREYYTLDSI
LFLLNNVHLSHPVYVRRAATENIPVVRRPDRKDLLGYLNGEASTSASIDRSAPLEIGLQR
STQVKRAADEVLAEAKKPRIEDEECVRLDKERLAARLEGHKEGIVQTEQIRSLSEAMSVE
KIAAIKAKIMAKKRSTIKTDLDDDITALKQRSFVDAEVDVTRDIVSRERVWRTRTTILQS
TGKNFSKNIFAILQSVKAREEGRAPEQRPAPNAAPVDPTLRTKQPIPAAYNRYDQERFKG
KEETEGFKIDTMGTYHGMTLKSVTEGASARKTQTPAAQPVPRPVSQARPPPNQKKGSRTP
IIIIPAATTSLITMLNAKDLLQDLKFVPSDEKKKQGCQRENETLIQRRKDQMQPGGTAIS
VTVPYRVVDQPLKLMPQDWDRVVAVFVQGPAWQFKGWPWLLPDGSPVDIFAKIKAFHLKY
DEVRLDPNVQKWDVTVLELSYHKRHLDRPVFLRFWETLDRYMVKHKSHLRF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6P1J9	1.000	1.000	6.369E-99	531	1.000	1.000	Q6P1J9.pdb.gz	CDC73_HUMAN Parafibromin OS=Homo sapiens OX=9606 GN=CDC73 PE=1 SV=1
2	AFDB:A0A1B0GUB2	0.345	0.405	1.649E-78	450	0.846	0.998	A0A1B0GUB2.pdb.gz	A0A1B0GUB2_HUMAN Cell division cycle 73 OS=Homo sapiens OX=9606 GN=CDC73 PE=1 SV=1
3	AFDB:Q9VHI1	0.355	0.350	6.698E-65	538	0.588	0.580	Q9VHI1.pdb.gz	Q9VHI1_DROME Hyrax OS=Drosophila melanogaster OX=7227 GN=hyx PE=2 SV=1
4	AFDB:Q06697	0.274	0.368	1.674E-23	393	0.186	0.252	Q06697.pdb.gz	CDC73_YEAST Cell division control protein 73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CDC73 PE=1 SV=1
5	AFDB:Q383Q6	0.283	0.379	2.821E-14	391	0.139	0.189	Q383Q6.pdb.gz	Q383Q6_TRYB2 Cell division control protein 73 C-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.1990 PE=3 SV=1
6	AFDB:Q3UP38	0.199	0.154	2.010E-4	726	0.113	0.083	Q3UP38.pdb.gz	EFC4B_MOUSE EF-hand calcium-binding domain-containing protein 4B OS=Mus musculus OX=10090 GN=Cracr2a PE=2 SV=2
7	PDB:2zetA	0.204	0.469	5.298E-4	181	0.036	0.105	2zetA.pdb.gz	Structural basis for the exclusive specificity of Slac2-a/melanophilin for the Rab27 GTPases.
8	PDB:8a4cB	0.186	0.454	1.124E-3	170	0.036	0.112	8a4cB.pdb.gz	Rep15 interacts with several Rab GTPases and has a distinct fold for a Rab effector.
9	PDB:6vijB	0.187	0.411	1.197E-3	191	0.032	0.089	6vijB.pdb.gz	Genetic and structural studies of RABL3 reveal an essential role in lymphoid development and function.
10	AFDB:Q7Z6P3	0.206	0.119	1.237E-3	1021	0.094	0.049	Q7Z6P3.pdb.gz	RAB44_HUMAN Ras-related protein Rab-44 OS=Homo sapiens OX=9606 GN=RAB44 PE=1 SV=4
11	PDB:6jikA	0.181	0.406	4.191E-3	182	0.049	0.143	6jikA.pdb.gz	Aspergillus fumigatus Rho1 gSGTP complex
12	PDB:5fkzE	0.157	0.123	5.057E-3	710	0.034	0.025	5fkzE.pdb.gz
13	PDB:7e1tB	0.167	0.374	5.057E-3	174	0.041	0.126	7e1tB.pdb.gz	Nde1 is a Rab9 effector for loading late endosomes to cytoplasmic dynein motor complex.
14	PDB:7nfxv	0.153	0.335	1.008E-2	186	0.040	0.113	7nfxv.pdb.gz	Receptor compaction and GTPase rearrangement drive SRP-mediated cotranslational protein translocation into the ER.
15	PDB:3cphA	0.211	0.505	1.142E-2	175	0.028	0.086	3cphA.pdb.gz	A structural model of the GDP dissociation inhibitor rab membrane extraction mechanism.
16	AFDB:Q6AZT7	0.161	0.077	1.181E-2	1300	0.105	0.043	Q6AZT7.pdb.gz	NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis OX=8355 GN=nphp3 PE=2 SV=1
17	PDB:1uptG	0.179	0.435	1.216E-2	170	0.038	0.118	1uptG.pdb.gz	Structural Basis for Arl1-Dependent Targeting of Homodimeric Grip Domains to the Golgi Apparatus
18	PDB:5sziA	0.198	0.475	1.295E-2	174	0.032	0.098	5sziA.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
19	AFDB:Q5A4X5	0.139	0.134	1.832E-2	559	0.105	0.100	Q5A4X5.pdb.gz	SKN7_CANAL Transcription factor SKN7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SKN7 PE=3 SV=1
20	AFDB:Q940B8	0.073	0.055	3.220E-2	794	0.070	0.047	Q940B8.pdb.gz	KN13A_ARATH Kinesin-like protein KIN-13A OS=Arabidopsis thaliana OX=3702 GN=KIN13A PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6P1J9	0.0	1091	531	1.000	1.000	CDC73_HUMAN Parafibromin OS=Homo sapiens OX=9606 GN=CDC73 PE=1 SV=1
2	Q7T3D4	0.0	966	521	0.889	0.906	Q7T3D4_DANRE Cdc73 protein OS=Danio rerio OX=7955 GN=hrpt2 PE=1 SV=1
3	Q8JZM7	0.0	1091	531	1.000	1.000	CDC73_MOUSE Parafibromin OS=Mus musculus OX=10090 GN=Cdc73 PE=1 SV=1
4	Q9VHI1	0.0	603	538	0.605	0.597	Q9VHI1_DROME Hyrax OS=Drosophila melanogaster OX=7227 GN=hyx PE=2 SV=1
5	X1WHN7	0.0	991	530	0.910	0.911	X1WHN7_DANRE Cell division cycle 73, Paf1/RNA polymerase II complex component, homolog (S. cerevisiae) OS=Danio rerio OX=7955 GN=hrpt2 PE=1 SV=1
6	A0A1B0GUB2	4.37e-168	485	450	0.458	0.540	A0A1B0GUB2_HUMAN Cell division cycle 73 OS=Homo sapiens OX=9606 GN=CDC73 PE=1 SV=1
7	Q9LJ87	9.35e-29	120	415	0.149	0.190	CDC73_ARATH Protein CDC73 homolog OS=Arabidopsis thaliana OX=3702 GN=CDC73 PE=1 SV=1
8	Q06697	1.54e-17	87.0	393	0.107	0.145	CDC73_YEAST Cell division control protein 73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CDC73 PE=1 SV=1
9	Q9UUE7	1.26e-13	74.7	371	0.109	0.156	CDC73_SCHPO Cell division control protein 73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cdc73 PE=3 SV=1
10	Q383Q6	1.07e-07	56.6	391	0.090	0.123	Q383Q6_TRYB2 Cell division control protein 73 C-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.1990 PE=3 SV=1
11	Q9VC45	0.47	35.8	1954	0.100	0.027	ASP_DROME Protein abnormal spindle OS=Drosophila melanogaster OX=7227 GN=asp PE=1 SV=3
12	A4AQI7	0.54	35.0	337	0.092	0.145	AXEP_MARSH L-Ala-D/L-amino acid epimerase OS=Maribacter sp. (strain HTCC2170 / KCCM 42371) OX=313603 GN=FB2170_14398 PE=3 SV=1
13	Q921S7	2.0	33.5	423	0.051	0.064	RM37_MOUSE Large ribosomal subunit protein mL37 OS=Mus musculus OX=10090 GN=Mrpl37 PE=1 SV=1
14	Q9ZV40	6.1	32.0	305	0.045	0.079	XTH21_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 21 OS=Arabidopsis thaliana OX=3702 GN=XTH21 PE=2 SV=1
15	P27282	8.1	32.0	2493	0.043	0.009	POLN_EEVVT Polyprotein P1234 OS=Venezuelan equine encephalitis virus (strain Trinidad donkey) OX=11038 PE=1 SV=3
16	Q57TR3	8.8	31.6	509	0.055	0.057	Q57TR3_TRYB2 Variant surface glycoprotein (VSG), putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.6N20.430 PE=4 SV=1
17	Q182W3	10.0	31.2	491	0.049	0.053	SP4A_CLOD6 Stage IV sporulation protein A OS=Clostridioides difficile (strain 630) OX=272563 GN=spoIVA PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05179 CDC73_C	1.4e-46	169.5	RNA pol II accessory factor, Cdc73 family, C-terminal
2	PF16050 CDC73_N	2.6e-135	462.2	Paf1 complex subunit CDC73 N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008834434.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008827988.1	0.999	LEO1 homolog, Paf1/RNA polymerase II complex component
2	1026970.XP_008851698.1	0.999	CTR9 homolog, Paf1/RNA polymerase II complex component
3	1026970.XP_008852178.1	0.998	PAF1 homolog, Paf1/RNA polymerase II complex component
4	1026970.XP_008821623.1	0.997	WD repeat domain 61
5	1026970.XP_008845018.1	0.997	RTF1 homolog, Paf1/RNA polymerase II complex component
6	1026970.XP_008854027.1	0.987	RNA polymerase II subunit A
7	1026970.XP_008852185.1	0.986	Transcription elongation factor SPT5 isoform X1
8	1026970.XP_008830920.1	0.954	SPT16 homolog, facilitates chromatin remodeling subunit
9	1026970.XP_008847656.1	0.953	Catenin beta-1
10	1026970.XP_008840915.1	0.936	Transcription elongation factor SPT4 isoform X1
11	1026970.XP_008838821.1	0.934	SPT6 homolog, histone chaperone
12	1026970.XP_008848491.1	0.926	Ribosome-binding protein 1 isoform X1
13	1026970.XP_008831507.1	0.925	DNA-directed RNA polymerase II subunit RPB2
14	1026970.XP_008836748.1	0.923	UBX domain-containing protein 7
15	1026970.XP_008834359.1	0.915	Structure specific recognition protein 1
16	1026970.XP_008835730.1	0.906	RNA polymerase II subunit G
17	1026970.XP_008833112.1	0.901	DNA-directed RNA polymerase II subunit RPB3
18	1026970.XP_008849500.1	0.895	RNA polymerase II subunit F
19	1026970.XP_008830505.1	0.879	RNA polymerase II subunit J
20	1026970.XP_008852647.1	0.855	RNA polymerase II subunit L

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.977	enzyme binding
GO:0000993	0.972	RNA polymerase II complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.991	regulation of cellular process
GO:0009987	0.988	cellular process
GO:0019222	0.949	regulation of metabolic process
GO:0060255	0.944	regulation of macromolecule metabolic process
GO:0031323	0.934	regulation of cellular metabolic process
GO:0080090	0.927	regulation of primary metabolic process
GO:0051171	0.925	regulation of nitrogen compound metabolic process
GO:0019219	0.923	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.913	regulation of RNA metabolic process
GO:0006355	0.903	regulation of DNA-templated transcription
GO:0048519	0.900	negative regulation of biological process
GO:0071704	0.855	organic substance metabolic process
GO:0048523	0.845	negative regulation of cellular process
GO:0044238	0.829	primary metabolic process
GO:0010558	0.829	negative regulation of macromolecule biosynthetic process
GO:0043170	0.771	macromolecule metabolic process
GO:0006807	0.749	nitrogen compound metabolic process
GO:0044237	0.745	cellular metabolic process
GO:0051253	0.732	negative regulation of RNA metabolic process
GO:0048518	0.672	positive regulation of biological process
GO:0006357	0.631	regulation of transcription by RNA polymerase II
GO:0048522	0.623	positive regulation of cellular process
GO:0050896	0.549	response to stimulus
GO:0032502	0.549	developmental process
GO:0032501	0.544	multicellular organismal process
GO:0048856	0.491	anatomical structure development
GO:0031327	0.469	negative regulation of cellular biosynthetic process
GO:0009893	0.464	positive regulation of metabolic process
GO:0034641	0.459	cellular nitrogen compound metabolic process
GO:1901360	0.458	organic cyclic compound metabolic process
GO:0046483	0.456	heterocycle metabolic process
GO:0006725	0.455	cellular aromatic compound metabolic process
GO:0010604	0.454	positive regulation of macromolecule metabolic process
GO:0090304	0.445	nucleic acid metabolic process
GO:0051173	0.440	positive regulation of nitrogen compound metabolic process
GO:0007275	0.425	multicellular organism development
GO:0010467	0.365	gene expression
GO:0045935	0.356	positive regulation of nucleobase-containing compound metabolic process
GO:0019538	0.322	protein metabolic process
GO:0016070	0.314	RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.995	cytosol
GO:0008023	0.995	transcription elongation factor complex
GO:0055029	0.995	nuclear DNA-directed RNA polymerase complex
GO:0016593	0.990	Cdc73/Paf1 complex
GO:0043232	0.976	intracellular non-membrane-bounded organelle
GO:0005694	0.557	chromosome
GO:0000781	0.386	chromosome, telomeric region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]