StarFunc result for job id Q6P1R3

User Input

>input (559 residues)
MAAPCGSELPANSPLKIPKMEVLSPASPGGLSDGNPSLSDPSTPRGASPLGPGSAAGSGA
AASGGLGLGLGGRSAASSSVSFSPGGGGGGAAAAAAAACRGMSWTPAETNALIAVWGNER
LVEARYQQLEGAGTVFGSKAPGPAMYERVSRALAELGYERTPSQCRERIKTLRRCYSRVK
EHGVGKRKSSYTFEQLEQVFGQGGWDAQPCQPVLINSSGLYQELESDGSTMEDYSQEDWG
NHSQDLHGYPTDQELDEIPVTKRTLKIKQESSEEAQKRDIMQNIVQILESVQLKWELFQS
WTDFSRLHLSNKLAIFGIGYNTRWKEDIRYHYAEISSQVPLGKRLREYFNSEKPEGRIIM
TRVQKMNWKNVYYKFLEITISEARCLELHMEIDWIPIAHSKPTGGNVVQYLLPGGIPKSP
GLYAIGYEECIERPLSPHMEQSSLDPGKEGRVDLETLSAQASLQVEIEPTRIIYCYLGIA
EVRTLQQCLFLHFQANTKTFSKDWVGINGFLSQNCIVDPGVSPKSIYIKFVEVERDFLSA
GSLVECLEKAIGYPLKFNN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9SYG2	0.136	0.190	5.755E-5	383	0.104	0.151	Q9SYG2.pdb.gz	ASIL1_ARATH Trihelix transcription factor ASIL1 OS=Arabidopsis thaliana OX=3702 GN=ASIL1 PE=1 SV=1
2	AFDB:F1QGF1	0.150	0.078	2.922E-4	1111	0.081	0.041	F1QGF1.pdb.gz	F1QGF1_DANRE Uncharacterized protein LOC503753 OS=Danio rerio OX=7955 GN=zgc:113263 PE=1 SV=3
3	AFDB:Q9LZS0	0.133	0.127	3.269E-4	591	0.107	0.102	Q9LZS0.pdb.gz	PTL_ARATH Trihelix transcription factor PTL OS=Arabidopsis thaliana OX=3702 GN=PTL PE=1 SV=1
4	AFDB:Q94JR1	0.137	0.141	2.197E-3	542	0.070	0.072	Q94JR1.pdb.gz	Q94JR1_ARATH UMP kinase OS=Arabidopsis thaliana OX=3702 GN=At3g10030 PE=1 SV=1
5	AFDB:Q39117	0.138	0.135	2.749E-3	575	0.088	0.085	Q39117.pdb.gz	TGT2_ARATH Trihelix transcription factor GT-2 OS=Arabidopsis thaliana OX=3702 GN=GT-2 PE=1 SV=1
6	AFDB:Q9NX65	0.149	0.122	3.074E-3	697	0.093	0.075	Q9NX65.pdb.gz	ZSC32_HUMAN Zinc finger and SCAN domain-containing protein 32 OS=Homo sapiens OX=9606 GN=ZSCAN32 PE=1 SV=3
7	AFDB:O23077	0.115	0.179	7.970E-3	319	0.064	0.113	O23077.pdb.gz	STKLN_ARATH Transcription factor STKL2 OS=Arabidopsis thaliana OX=3702 GN=STKL2 PE=1 SV=1
8	AFDB:Q9LJG8	0.132	0.163	7.970E-3	443	0.089	0.113	Q9LJG8.pdb.gz	ASIL2_ARATH Trihelix transcription factor ASIL2 OS=Arabidopsis thaliana OX=3702 GN=ASIL2 PE=1 SV=1
9	AFDB:Q8H181	0.116	0.106	8.429E-3	619	0.129	0.116	Q8H181.pdb.gz	GTL2_ARATH Trihelix transcription factor GTL2 OS=Arabidopsis thaliana OX=3702 GN=At5g28300 PE=2 SV=1
10	AFDB:Q8IWY8	0.142	0.095	1.320E-2	852	0.095	0.062	Q8IWY8.pdb.gz	ZSC29_HUMAN Zinc finger and SCAN domain-containing protein 29 OS=Homo sapiens OX=9606 GN=ZSCAN29 PE=1 SV=2
11	PDB:4behB	0.062	0.221	7.930E-1	116	0.043	0.207	4behB.pdb.gz
12	PDB:6vlsD	0.055	0.039	1.838	963	0.036	0.021	6vlsD.pdb.gz
13	PDB:7nv0A	0.109	0.136	1.944	430	0.014	0.019	7nv0A.pdb.gz	Cryo-EM structure of human Pol kappa bound to DNA and mono-ubiquitylated PCNA.
14	PDB:3j4qB	0.073	0.093	2.056	382	0.066	0.097	3j4qB.pdb.gz
15	PDB:1jfiB	0.058	0.159	2.300	135	0.032	0.133	1jfiB.pdb.gz	Crystal structure of negative cofactor 2 recognizing the TBP-DNA transcription complex.
16	PDB:3gc3A	0.063	0.085	2.721	329	0.032	0.055	3gc3A.pdb.gz
17	PDB:3besR	0.052	0.099	2.877	250	0.023	0.052	3besR.pdb.gz
18	PDB:5im3A	0.076	0.055	2.877	874	0.029	0.018	5im3A.pdb.gz	Structural Mechanism of Allosteric Activity Regulation in a Ribonucleotide Reductase with Double ATP Cones.
19	PDB:6pgvA	0.094	0.239	3.404	152	0.021	0.079	6pgvA.pdb.gz	Structural insights into the activity and regulation of human Josephin-2
20	PDB:6tljS	0.065	0.105	3.404	293	0.029	0.055	6tljS.pdb.gz	A unique binding mode of Nek2A to the APC/C allows its ubiquitination during prometaphase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1QGF1	4.15e-07	55.5	1111	0.070	0.035	F1QGF1_DANRE Uncharacterized protein LOC503753 OS=Danio rerio OX=7955 GN=zgc:113263 PE=1 SV=3
2	Q9C6K3	7.27e-05	48.1	603	0.057	0.053	DF1_ARATH Trihelix transcription factor DF1 OS=Arabidopsis thaliana OX=3702 GN=DF1 PE=4 SV=1
3	Q9FX53	3.27e-04	45.8	406	0.052	0.071	TGT1_ARATH Trihelix transcription factor GT-1 OS=Arabidopsis thaliana OX=3702 GN=GT-1 PE=1 SV=1
4	Q39117	3.97e-04	45.4	575	0.054	0.052	TGT2_ARATH Trihelix transcription factor GT-2 OS=Arabidopsis thaliana OX=3702 GN=GT-2 PE=1 SV=1
5	Q9C882	5.96e-04	45.1	587	0.045	0.043	GTL1_ARATH Trihelix transcription factor GTL1 OS=Arabidopsis thaliana OX=3702 GN=GTL1 PE=1 SV=2
6	Q9LU92	8.84e-04	44.3	372	0.047	0.070	TGT4_ARATH Trihelix transcription factor GT-4 OS=Arabidopsis thaliana OX=3702 GN=GT-4 PE=2 SV=1
7	Q700D8	0.001	44.3	481	0.073	0.085	Q700D8_ARATH At3g10000 OS=Arabidopsis thaliana OX=3702 GN=EDA31 PE=2 SV=1
8	Q8VZ20	0.005	41.6	314	0.066	0.118	ASR3_ARATH Trihelix transcription factor ASR3 OS=Arabidopsis thaliana OX=3702 GN=ASR3 PE=1 SV=1
9	Q9LZS0	0.007	41.6	591	0.039	0.037	PTL_ARATH Trihelix transcription factor PTL OS=Arabidopsis thaliana OX=3702 GN=PTL PE=1 SV=1
10	Q8H181	0.018	40.4	619	0.045	0.040	GTL2_ARATH Trihelix transcription factor GTL2 OS=Arabidopsis thaliana OX=3702 GN=At5g28300 PE=2 SV=1
11	Q9C7F7	0.076	37.4	193	0.043	0.124	LTPG1_ARATH Non-specific lipid transfer protein GPI-anchored 1 OS=Arabidopsis thaliana OX=3702 GN=LTPG1 PE=2 SV=1
12	Q8IWY8	0.080	38.5	852	0.048	0.032	ZSC29_HUMAN Zinc finger and SCAN domain-containing protein 29 OS=Homo sapiens OX=9606 GN=ZSCAN29 PE=1 SV=2
13	Q9FGJ1	0.23	36.6	398	0.034	0.048	Q9FGJ1_ARATH Homeodomain-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=MNJ7.25 PE=1 SV=1
14	O53370	0.34	36.2	590	0.104	0.098	O53370_MYCTU Succinate dehydrogenase flavoprotein subunit OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=sdhA PE=1 SV=1
15	Q8IFM2	0.36	36.2	2380	0.066	0.016	Q8IFM2_PLAF7 Surface-associated interspersed protein 4.2 (SURFIN 4.2) OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0424400 PE=4 SV=1
16	A0A384LCJ3	0.42	35.4	321	0.066	0.115	A0A384LCJ3_ARATH (thale cress) hypothetical protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g53170 PE=1 SV=1
17	Q8GXR6	0.42	35.4	321	0.066	0.115	Q8GXR6_ARATH Sequence-specific DNA binding transcription factor OS=Arabidopsis thaliana OX=3702 GN=At3g58630 PE=1 SV=1
18	A1L167	0.51	34.3	161	0.052	0.180	U2QL1_HUMAN Ubiquitin-conjugating enzyme E2Q-like protein 1 OS=Homo sapiens OX=9606 GN=UBE2QL1 PE=1 SV=2
19	Q9NX65	0.58	35.4	697	0.039	0.032	ZSC32_HUMAN Zinc finger and SCAN domain-containing protein 32 OS=Homo sapiens OX=9606 GN=ZSCAN32 PE=1 SV=3
20	Q9LV59	0.62	35.0	333	0.055	0.093	Q9LV59_ARATH Alcohol dehydrogenase transcription factor Myb/SANT-like family protein OS=Arabidopsis thaliana OX=3702 GN=At3g24490 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10545 MADF_DNA_bdg	44	15.9	Alcohol dehydrogenase transcription factor Myb/SANT-like
2	PF00249 Myb_DNA-binding	5.2e+02	12.3	Myb-like DNA-binding domain
3	PF13837 Myb_DNA-bind_4	1.5e-18	78.3	Myb/SANT-like DNA-binding domain
4	PF13921 Myb_DNA-bind_6	7.1e+02	11.9	Myb-like DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 34839.XP_005378500.1

Rank	PPI partner	STRING score	Description
1	34839.XP_005406221.1	0.566	Krueppel-like factor 16

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.968	nucleic acid binding
GO:0043565	0.962	sequence-specific DNA binding
GO:1990837	0.945	sequence-specific double-stranded DNA binding
GO:0000976	0.933	transcription cis-regulatory region binding
GO:0140110	0.645	transcription regulator activity
GO:0003700	0.504	DNA-binding transcription factor activity
GO:0000981	0.327	DNA-binding transcription factor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0019222	0.996	regulation of metabolic process
GO:0006355	0.993	regulation of DNA-templated transcription
GO:0009987	0.952	cellular process
GO:0048523	0.893	negative regulation of cellular process
GO:0031324	0.879	negative regulation of cellular metabolic process
GO:0048518	0.844	positive regulation of biological process
GO:0051172	0.836	negative regulation of nitrogen compound metabolic process
GO:0048522	0.832	positive regulation of cellular process
GO:0010605	0.828	negative regulation of macromolecule metabolic process
GO:0006357	0.752	regulation of transcription by RNA polymerase II
GO:0050896	0.623	response to stimulus
GO:0045934	0.578	negative regulation of nucleobase-containing compound metabolic process
GO:0032501	0.493	multicellular organismal process
GO:0032502	0.489	developmental process
GO:0051716	0.424	cellular response to stimulus
GO:0009890	0.415	negative regulation of biosynthetic process
GO:0031327	0.409	negative regulation of cellular biosynthetic process
GO:0007275	0.407	multicellular organism development
GO:0010558	0.405	negative regulation of macromolecule biosynthetic process
GO:0031325	0.389	positive regulation of cellular metabolic process
GO:0051173	0.383	positive regulation of nitrogen compound metabolic process
GO:0071704	0.364	organic substance metabolic process
GO:0045935	0.363	positive regulation of nucleobase-containing compound metabolic process
GO:0044237	0.359	cellular metabolic process
GO:0048731	0.350	system development
GO:0044238	0.348	primary metabolic process
GO:1902679	0.345	negative regulation of RNA biosynthetic process
GO:0042221	0.341	response to chemical
GO:0071840	0.339	cellular component organization or biogenesis
GO:1903507	0.337	negative regulation of nucleic acid-templated transcription
GO:0045892	0.323	negative regulation of DNA-templated transcription
GO:0048583	0.322	regulation of response to stimulus
GO:0010604	0.318	positive regulation of macromolecule metabolic process
GO:0006807	0.317	nitrogen compound metabolic process
GO:0016043	0.314	cellular component organization
GO:0031328	0.313	positive regulation of cellular biosynthetic process
GO:0010557	0.312	positive regulation of macromolecule biosynthetic process
GO:0051254	0.312	positive regulation of RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.693	nuclear lumen
GO:0005654	0.460	nucleoplasm
GO:0005737	0.419	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]