StarFunc result for job id Q6P2D0

User Input

>input (407 residues)
MNKSQGSVSFTDVTVDFTQEEWEQLDPSQRILYMDVMLENYSNLLSVEVWKADDQMERDH
RNPDEQARQFLILKNQTPIEERGDLFGKALNLNTDFVSLRQVPYKYDLYEKTLKYNSDLL
NSNRSYAGKQTDECNEFGKALLYLKQEKTHSGVEYSEYNKSGKALSHKAAIFKHQKIKNL
VQPFICTYCDKAFSFKSLLISHKRIHTGEKPYECNVCKKTFSHKANLIKHQRIHTGEKPF
ECPECGKAFTHQSNLIVHQRAHMEKKPYECSECGKTFAQKFELTTHQRIHTGERPYECNE
CAKTFFKKSNLIIHQKIHTGEKRYECSECGKSFIQNSQLIIHMRTHTGEKPYECTECGKT
FSQRSTLRLHLRIHTGEKPYECSECGKAFSRKSRLSVHQRVHIGEKP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6P2D0	1.000	1.000	5.273E-67	407	1.000	1.000	Q6P2D0.pdb.gz	ZFP1_HUMAN Zinc finger protein 1 homolog OS=Homo sapiens OX=9606 GN=ZFP1 PE=1 SV=2
2	AFDB:Q5MCW4	0.480	0.293	5.427E-35	686	0.482	0.286	Q5MCW4.pdb.gz	ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens OX=9606 GN=ZNF569 PE=1 SV=1
3	AFDB:F8WEZ9	0.540	0.450	1.072E-34	492	0.450	0.372	F8WEZ9.pdb.gz	F8WEZ9_HUMAN Zinc finger protein 480 OS=Homo sapiens OX=9606 GN=ZNF480 PE=1 SV=1
4	AFDB:Q9HCZ1	0.465	0.294	2.509E-34	680	0.479	0.287	Q9HCZ1.pdb.gz	ZN334_HUMAN Zinc finger protein 334 OS=Homo sapiens OX=9606 GN=ZNF334 PE=1 SV=2
5	AFDB:A2AWF2	0.496	0.308	3.148E-34	685	0.445	0.264	A2AWF2.pdb.gz	A2AWF2_MOUSE Reduced expression 2 OS=Mus musculus OX=10090 GN=Rex2 PE=1 SV=1
6	AFDB:Q147U1	0.506	0.396	3.731E-34	533	0.455	0.347	Q147U1.pdb.gz	ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens OX=9606 GN=ZNF846 PE=1 SV=2
7	AFDB:Q9C0F3	0.535	0.467	3.949E-34	470	0.435	0.377	Q9C0F3.pdb.gz	ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens OX=9606 GN=ZNF436 PE=1 SV=2
8	AFDB:P17014	0.469	0.289	4.179E-34	697	0.538	0.314	P17014.pdb.gz	ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens OX=9606 GN=ZNF12 PE=1 SV=3
9	AFDB:Q9HBT8	0.518	0.414	5.243E-34	521	0.450	0.351	Q9HBT8.pdb.gz	Z286A_HUMAN Zinc finger protein 286A OS=Homo sapiens OX=9606 GN=ZNF286A PE=1 SV=1
10	AFDB:Q7Z3V5	0.534	0.365	5.549E-34	609	0.437	0.292	Q7Z3V5.pdb.gz	ZN571_HUMAN Zinc finger protein 571 OS=Homo sapiens OX=9606 GN=ZNF571 PE=2 SV=3
11	PDB:3w5kB	0.113	0.271	1.343E-4	110	0.101	0.373	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:7nacw	0.078	0.056	9.324E-1	672	0.128	0.077	7nacw.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
13	PDB:6wkrC	0.091	0.067	1.310	606	0.115	0.078	6wkrC.pdb.gz	JARID2 and AEBP2 regulate PRC2 in the presence of H2AK119ub1 and other histone modifications.
14	PDB:7ungi	0.075	0.107	1.468	250	0.088	0.144	7ungi.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
15	PDB:7ung2	0.068	0.065	2.587	446	0.098	0.090	7ung2.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
16	PDB:6n8jb	0.073	0.055	3.848	647	0.118	0.074	6n8jb.pdb.gz	Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.
17	PDB:6tm5N	0.100	0.072	3.848	676	0.113	0.068	6tm5N.pdb.gz	A unique binding mode of Nek2A to the APC/C allows its ubiquitination during prometaphase.
18	PDB:2kr0A	0.087	0.087	4.072	407	0.084	0.084	2kr0A.pdb.gz
19	PDB:6v92R	0.072	0.087	4.310	325	0.108	0.135	6v92R.pdb.gz	Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement.
20	PDB:7qo48	0.074	0.079	4.310	372	0.032	0.035	7qo48.pdb.gz	Allosteric control of Ubp6 and the proteasome via a bidirectional switch.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6P2D0	0.0	850	407	1.000	1.000	ZFP1_HUMAN Zinc finger protein 1 homolog OS=Homo sapiens OX=9606 GN=ZFP1 PE=1 SV=2
2	P17014	2.87e-131	395	697	0.565	0.330	ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens OX=9606 GN=ZNF12 PE=1 SV=3
3	Q5MCW4	1.03e-130	393	686	0.518	0.308	ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens OX=9606 GN=ZNF569 PE=1 SV=1
4	Q9HCZ1	2.37e-127	384	680	0.516	0.309	ZN334_HUMAN Zinc finger protein 334 OS=Homo sapiens OX=9606 GN=ZNF334 PE=1 SV=2
5	Q8N184	3.75e-123	372	647	0.499	0.314	ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens OX=9606 GN=ZNF567 PE=1 SV=3
6	Q9NYW8	1.30e-122	373	714	0.504	0.287	RBAK_HUMAN RB-associated KRAB zinc finger protein OS=Homo sapiens OX=9606 GN=RBAK PE=1 SV=1
7	Q86U76	3.69e-121	359	410	0.477	0.473	Q86U76_HUMAN Zinc finger protein 3 OS=Homo sapiens OX=9606 GN=ZNF3 PE=1 SV=1
8	P17036	5.94e-121	360	446	0.477	0.435	ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens OX=9606 GN=ZNF3 PE=1 SV=3
9	Q6PF04	1.40e-120	365	617	0.491	0.324	ZN613_HUMAN Zinc finger protein 613 OS=Homo sapiens OX=9606 GN=ZNF613 PE=1 SV=2
10	P17030	1.80e-120	359	456	0.489	0.436	ZNF25_HUMAN Zinc finger protein 25 OS=Homo sapiens OX=9606 GN=ZNF25 PE=1 SV=2
11	Q8NA42	2.61e-120	359	475	0.504	0.432	ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens OX=9606 GN=ZNF383 PE=1 SV=1
12	Q8WV37	6.81e-120	360	535	0.484	0.368	ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens OX=9606 GN=ZNF480 PE=1 SV=2
13	P51523	1.09e-118	363	738	0.514	0.283	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
14	F8WEZ9	5.10e-118	354	492	0.467	0.386	F8WEZ9_HUMAN Zinc finger protein 480 OS=Homo sapiens OX=9606 GN=ZNF480 PE=1 SV=1
15	P17032	5.11e-118	356	561	0.514	0.373	ZN37A_HUMAN Zinc finger protein 37A OS=Homo sapiens OX=9606 GN=ZNF37A PE=2 SV=3
16	Q9GZX5	7.36e-118	355	532	0.477	0.365	ZN350_HUMAN Zinc finger protein 350 OS=Homo sapiens OX=9606 GN=ZNF350 PE=1 SV=3
17	Q14587	3.27e-117	365	947	0.494	0.212	ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens OX=9606 GN=ZNF268 PE=1 SV=2
18	Q9C0F3	8.47e-117	350	470	0.469	0.406	ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens OX=9606 GN=ZNF436 PE=1 SV=2
19	A0A0U1RQ46	3.94e-116	353	609	0.445	0.297	A0A0U1RQ46_MOUSE Zinc finger protein 950 OS=Mus musculus OX=10090 GN=Zfp950 PE=4 SV=1
20	Q96RE9	5.10e-116	352	604	0.445	0.300	ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens OX=9606 GN=ZNF300 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00130 C1_1	22	16.4	Phorbol esters/diacylglycerol binding domain (C1 domain)
2	PF07975 C1_4	0.21	23.2	TFIIH C1-like domain
3	PF14353 CpXC	58	15.2	CpXC protein
4	PF12773 DZR	10	17.5	Double zinc ribbon
5	PF09538 FYDLN_acid	95	15.1	Protein of unknown function (FYDLN_acid)
6	PF19335 HMBD	8.7e+02	11.3	Heavy metal binding domain
7	PF07754 HVO_2753_ZBP	37	15.5	Small zinc finger protein HVO_2753-like, Zn-binding pocket
8	PF01155 HypA	9.8	17.6	Hydrogenase/urease nickel incorporation, metallochaperone, hypA
9	PF01352 KRAB	2.6e-20	83.1	KRAB box
10	PF02150 RNA_POL_M_15KD	40	15.5	RNA polymerases M/15 Kd subunit
11	PF01286 XPA_N	19	16.7	XPA protein N-terminal
12	PF14149 YhfH	30	16.0	YhfH-like protein
13	PF01428 zf-AN1	3.6	19.1	AN1-like Zinc finger
14	PF00096 zf-C2H2	6e-50	176.1	Zinc finger, C2H2 type
15	PF16622 zf-C2H2_11	0.23	22.6	zinc-finger C2H2-type
16	PF13894 zf-C2H2_4	2.5e-27	104.2	C2H2-type zinc finger
17	PF13912 zf-C2H2_6	2.6e-16	70.4	C2H2-type zinc finger
18	PF15909 zf-C2H2_8	36	16.1	C2H2-type zinc ribbon
19	PF12171 zf-C2H2_jaz	7.6e-13	59.6	Zinc-finger double-stranded RNA-binding
20	PF05605 zf-Di19	0.34	22.5	Drought induced 19 protein (Di19), zinc-binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000377080

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000366221	0.910	Zinc finger protein castor homolog 1
2	9606.ENSP00000384849	0.886	Cyclin-dependent kinase inhibitor 1
3	9606.ENSP00000479618	0.870	Myc proto-oncogene protein
4	9606.ENSP00000439244	0.722	Cip1-interacting zinc finger protein
5	9606.ENSP00000381657	0.660	Histone-lysine N-methyltransferase, H3 lysine-79 specific
6	9606.ENSP00000215832	0.567	Mitogen-activated protein kinase 1
7	9606.ENSP00000379895	0.555	Glycine amidinotransferase, mitochondrial
8	9606.ENSP00000235372	0.549	PR domain zinc finger protein 2
9	9606.ENSP00000433109	0.532	Potassium voltage-gated channel subfamily A member 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.785	nucleic acid binding
GO:0003677	0.656	DNA binding
GO:0043565	0.518	sequence-specific DNA binding
GO:1990837	0.378	sequence-specific double-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.999	regulation of biological process
GO:0050794	0.994	regulation of cellular process
GO:0009889	0.980	regulation of biosynthetic process
GO:0010468	0.980	regulation of gene expression
GO:0019219	0.975	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.974	regulation of macromolecule biosynthetic process
GO:0051252	0.957	regulation of RNA metabolic process
GO:0006355	0.935	regulation of DNA-templated transcription
GO:0048519	0.720	negative regulation of biological process
GO:0009987	0.672	cellular process
GO:0048522	0.540	positive regulation of cellular process
GO:0048523	0.522	negative regulation of cellular process
GO:0071704	0.482	organic substance metabolic process
GO:0006357	0.469	regulation of transcription by RNA polymerase II
GO:0050896	0.464	response to stimulus
GO:0009893	0.447	positive regulation of metabolic process
GO:0010604	0.444	positive regulation of macromolecule metabolic process
GO:0044238	0.439	primary metabolic process
GO:0044237	0.438	cellular metabolic process
GO:0009892	0.434	negative regulation of metabolic process
GO:0031325	0.424	positive regulation of cellular metabolic process
GO:0051173	0.406	positive regulation of nitrogen compound metabolic process
GO:0010605	0.399	negative regulation of macromolecule metabolic process
GO:0031324	0.385	negative regulation of cellular metabolic process
GO:0051172	0.384	negative regulation of nitrogen compound metabolic process
GO:0010558	0.346	negative regulation of macromolecule biosynthetic process
GO:0031327	0.346	negative regulation of cellular biosynthetic process
GO:0045934	0.346	negative regulation of nucleobase-containing compound metabolic process
GO:0010557	0.338	positive regulation of macromolecule biosynthetic process
GO:0031328	0.338	positive regulation of cellular biosynthetic process
GO:0045935	0.338	positive regulation of nucleobase-containing compound metabolic process
GO:0051716	0.330	cellular response to stimulus
GO:1902680	0.310	positive regulation of RNA biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.979	cytoplasm
GO:0043228	0.916	non-membrane-bounded organelle
GO:0043232	0.901	intracellular non-membrane-bounded organelle
GO:0005829	0.858	cytosol
GO:0005730	0.746	nucleolus
GO:0032991	0.373	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]