StarFunc result for job id Q6P2E9

User Input

>input (1401 residues)
MASCASIDIEDATQHLRDILKLDRPAGGPSAESPRPSSAYNGDLNGLLVPDPLCSGDSTS
ANKTGLRTMPPINLQEKQVICLSGDDSSTCIGILAKEVEIVASSDSSISSKARGSNKVKI
QPVAKYDWEQKYYYGNLIAVSNSFLAYAIRAANNGSAMVRVISVSTSERTLLKGFTGSVA
DLAFAHLNSPQLACLDEAGNLFVWRLALVNGKIQEEILVHIRQPEGTPLNHFRRIIWCPF
IPEESEDCCEESSPTVALLHEDRAEVWDLDMLRSSHSTWPVDVSQIKQGFIVVKGHSTCL
SEGALSPDGTVLATASHDGYVKFWQIYIEGQDEPRCLHEWKPHDGRPLSCLLFCDNHKKQ
DPDVPFWRFLITGADQNRELKMWCTVSWTCLQTIRFSPDIFSSVSVPPSLKVCLDLSAEY
LILSDVQRKVLYVMELLQNQEEGHACFSSISEFLLTHPVLSFGIQVVSRCRLRHTEVLPA
EEENDSLGADGTHGAGAMESAAGVLIKLFCVHTKALQDVQIRFQPQLNPDVVAPLPTHTA
HEDFTFGESRPELGSEGLGSAAHGSQPDLRRIVELPAPADFLSLSSETKPKLMTPDAFMT
PSASLQQITASPSSSSSGSSSSSSSSSSSLTAVSAMSSTSAVDPSLTRPPEELTLSPKLQ
LDGSLTMSSSGSLQASPRGLLPGLLPAPADKLTPKGPGQVPTATSALSLELQEVEPLGLP
QASPSRTRSPDVISSASTALSQDIPEIASEALSRGFGSSAPEGLEPDSMASAASALHLLS
PRPRPGPELGPQLGLDGGPGDGDRHNTPSLLEAALTQEASTPDSQVWPTAPDITRETCST
LAESPRNGLQEKHKSLAFHRPPYHLLQQRDSQDASAEQSDHDDEVASLASASGGFGTKVP
APRLPAKDWKTKGSPRTSPKLKRKSKKDDGDAAMGSRLTEHQVAEPPEDWPALIWQQQRE
LAELRHSQEELLQRLCTQLEGLQSTVTGHVERALETRHEQEQRRLERALAEGQQRGGQLQ
EQLTQQLSQALSSAVAGRLERSIRDEIKKTVPPCVSRSLEPMAGQLSNSVATKLTAVEGS
MKENISKLLKSKNLTDAIARAAADTLQGPMQAAYREAFQSVVLPAFEKSCQAMFQQINDS
FRLGTQEYLQQLESHMKSRKAREQEAREPVLAQLRGLVSTLQSATEQMAATVAGSVRAEV
QHQLHVAVGSLQESILAQVQRIVKGEVSVALKEQQAAVTSSIMQAMRSAAGTPVPSAHLD
CQAQQAHILQLLQQGHLNQAFQQALTAADLNLVLYVCETVDPAQVFGQPPCPLSQPVLLS
LIQQLASDLGTRTDLKLSYLEEAVMHLDHSDPITRDHMGSVMAQVRQKLFQFLQAEPHNS
LGKAARRLSLMLHGLVTPSLP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3UJB9	0.360	0.359	0.000	1406	0.951	0.948	Q3UJB9.pdb.gz	EDC4_MOUSE Enhancer of mRNA-decapping protein 4 OS=Mus musculus OX=10090 GN=Edc4 PE=1 SV=2
2	AFDB:Q9LTT8	0.238	0.248	4.337E-48	1344	0.201	0.210	Q9LTT8.pdb.gz	VCS_ARATH Enhancer of mRNA-decapping protein 4 OS=Arabidopsis thaliana OX=3702 GN=VCS PE=1 SV=1
3	AFDB:Q54J96	0.191	0.182	8.664E-37	1476	0.177	0.168	Q54J96.pdb.gz	Q54J96_DICDI Enhancer of mRNA-decapping protein 4 WD40 repeat region domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0288241 PE=4 SV=1
4	PDB:1vyhC	0.167	0.643	1.425E-11	310	0.041	0.184	1vyhC.pdb.gz
5	PDB:7styA	0.197	0.634	1.671E-11	390	0.045	0.162	7styA.pdb.gz
6	PDB:4v7fq	0.160	0.441	2.555E-11	443	0.042	0.133	4v7fq.pdb.gz	60S ribosome biogenesis requires rotation of the 5S ribonucleoprotein particle.
7	PDB:7mq8LR	0.171	0.298	3.514E-11	773	0.041	0.075	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
8	PDB:5k1aF	0.168	0.365	4.121E-11	600	0.038	0.088	5k1aF.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
9	PDB:5nnzA	0.173	0.586	5.096E-11	335	0.033	0.137	5nnzA.pdb.gz
10	PDB:5yzgs	0.161	0.516	6.303E-11	374	0.039	0.147	5yzgs.pdb.gz	Structure of a human catalytic step I spliceosome
11	PDB:2hesX	0.173	0.658	7.009E-11	308	0.040	0.182	2hesX.pdb.gz
12	PDB:2h9lA	0.177	0.668	1.016E-10	321	0.036	0.159	2h9lA.pdb.gz
13	PDB:7bt6x	0.173	0.432	1.130E-10	488	0.046	0.131	7bt6x.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
14	AFDB:P40477	0.166	0.160	6.057E-10	1460	0.085	0.082	P40477.pdb.gz	NU159_YEAST Nucleoporin NUP159 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NUP159 PE=1 SV=1
15	AFDB:Q09847	0.192	0.201	7.491E-10	1325	0.125	0.132	Q09847.pdb.gz	NU146_SCHPO Nucleoporin nup146 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nup146 PE=1 SV=1
16	AFDB:Q9V4C8	0.123	0.117	2.825E-9	1500	0.101	0.095	Q9V4C8.pdb.gz	HCF_DROME Host cell factor OS=Drosophila melanogaster OX=7227 GN=Hcf PE=1 SV=2
17	AFDB:Q9NRJ4	0.172	0.158	2.364E-8	1543	0.106	0.096	Q9NRJ4.pdb.gz	TULP4_HUMAN Tubby-related protein 4 OS=Homo sapiens OX=9606 GN=TULP4 PE=1 SV=2
18	AFDB:A0A0B4KI44	0.155	0.152	2.628E-8	1433	0.095	0.093	A0A0B4KI44.pdb.gz	A0A0B4KI44_DROME Tusp, isoform F OS=Drosophila melanogaster OX=7227 GN=Tusp PE=3 SV=1
19	AFDB:Q9R0X5	0.121	0.158	6.836E-8	1001	0.082	0.115	Q9R0X5.pdb.gz	RPGR_MOUSE X-linked retinitis pigmentosa GTPase regulator OS=Mus musculus OX=10090 GN=Rpgr PE=1 SV=2
20	AFDB:Q389F7	0.160	0.198	8.294E-7	1105	0.097	0.123	Q389F7.pdb.gz	Q389F7_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.26.0030 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3UJB9	0.0	2536	1406	0.949	0.945	EDC4_MOUSE Enhancer of mRNA-decapping protein 4 OS=Mus musculus OX=10090 GN=Edc4 PE=1 SV=2
2	Q6P2E9	0.0	2850	1401	1.000	1.000	EDC4_HUMAN Enhancer of mRNA-decapping protein 4 OS=Homo sapiens OX=9606 GN=EDC4 PE=1 SV=1
3	Q9VKK1	4.89e-65	245	1354	0.112	0.116	EDC4_DROME Enhancer of mRNA-decapping protein 4 homolog OS=Drosophila melanogaster OX=7227 GN=Ge-1 PE=1 SV=2
4	Q9LTT8	1.10e-21	105	1344	0.064	0.067	VCS_ARATH Enhancer of mRNA-decapping protein 4 OS=Arabidopsis thaliana OX=3702 GN=VCS PE=1 SV=1
5	Q9LTT9	3.27e-21	103	1340	0.068	0.071	VCR_ARATH Varicose-related protein OS=Arabidopsis thaliana OX=3702 GN=VCR PE=2 SV=1
6	Q54J96	8.08e-10	66.2	1476	0.034	0.032	Q54J96_DICDI Enhancer of mRNA-decapping protein 4 WD40 repeat region domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0288241 PE=4 SV=1
7	F4HTH8	0.002	45.1	1181	0.025	0.030	KTN82_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.2 OS=Arabidopsis thaliana OX=3702 GN=KTN80.2 PE=1 SV=1
8	O88879	0.003	44.7	1249	0.029	0.032	APAF_MOUSE Apoptotic protease-activating factor 1 OS=Mus musculus OX=10090 GN=Apaf1 PE=1 SV=3
9	Q20168	0.003	44.7	1000	0.031	0.043	COPB2_CAEEL Probable coatomer subunit beta' OS=Caenorhabditis elegans OX=6239 GN=copb-2 PE=3 SV=3
10	A0A1P8AW69	0.008	43.1	1019	0.023	0.031	KTN81_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.1 OS=Arabidopsis thaliana OX=3702 GN=KTN80.1 PE=1 SV=1
11	Q6JWU7	0.012	42.7	934	0.025	0.037	Q6JWU7_DANRE Coatomer subunit beta' OS=Danio rerio OX=7955 GN=sb:cb121 PE=1 SV=1
12	O62621	0.026	41.6	914	0.025	0.038	COPB2_DROME Coatomer subunit beta' OS=Drosophila melanogaster OX=7227 GN=beta'COP PE=2 SV=2
13	Q9EPV5	0.032	41.2	1249	0.028	0.031	APAF_RAT Apoptotic protease-activating factor 1 OS=Rattus norvegicus OX=10116 GN=Apaf1 PE=1 SV=1
14	Q7ZTX2	0.044	40.0	334	0.021	0.090	Q7ZTX2_DANRE WD repeat domain 5 OS=Danio rerio OX=7955 GN=wu:fk47f04 PE=1 SV=1
15	O14727	0.050	40.8	1248	0.028	0.031	APAF_HUMAN Apoptotic protease-activating factor 1 OS=Homo sapiens OX=9606 GN=APAF1 PE=1 SV=2
16	Q388K3	0.063	40.0	589	0.027	0.065	Q388K3_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.2920 PE=4 SV=1
17	Q54KL5	0.068	39.7	335	0.023	0.096	WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum OX=44689 GN=wdr5 PE=3 SV=1
18	P61964	0.076	39.3	334	0.021	0.090	WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens OX=9606 GN=WDR5 PE=1 SV=1
19	P61965	0.076	39.3	334	0.021	0.090	WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus OX=10090 GN=Wdr5 PE=1 SV=1
20	Q498M4	0.076	39.3	334	0.021	0.090	WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus OX=10116 GN=Wdr5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04286 DUF445	88	14.3	Protein of unknown function (DUF445)
2	PF16529 Ge1_WD40	1.2e-150	512.7	WD40 region of Ge1, enhancer of mRNA-decapping protein
3	PF00400 WD40	0.071	25.2	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000351811

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000373715	0.999	m7GpppN-mRNA hydrolase
2	9606.ENSP00000476046	0.999	mRNA-decapping enzyme 1A
3	9606.ENSP00000320503	0.998	Enhancer of mRNA-decapping protein 3
4	9606.ENSP00000478754	0.998	Probable ATP-dependent RNA helicase DDX6
5	9606.ENSP00000280665	0.994	mRNA-decapping enzyme 1B
6	9606.ENSP00000300146	0.992	Protein PAT1 homolog 1
7	9606.ENSP00000310596	0.987	U6 snRNA-associated Sm-like protein LSm1
8	9606.ENSP00000264951	0.974	5'-3' exoribonuclease 1
9	9606.ENSP00000469468	0.968	U6 snRNA-associated Sm-like protein LSm4
10	9606.ENSP00000302160	0.955	U6 snRNA-associated Sm-like protein LSm3
11	9606.ENSP00000364813	0.949	U6 snRNA-associated Sm-like protein LSm2
12	9606.ENSP00000252622	0.946	U6 snRNA-associated Sm-like protein LSm7
13	9606.ENSP00000410758	0.940	U6 snRNA-associated Sm-like protein LSm5
14	9606.ENSP00000422392	0.913	U6 snRNA-associated Sm-like protein LSm6
15	9606.ENSP00000356669	0.907	Roquin-1
16	9606.ENSP00000446271	0.905	Protein LSM14 homolog A
17	9606.ENSP00000379144	0.859	Trinucleotide repeat-containing gene 6A protein
18	9606.ENSP00000377681	0.812	Ras GTPase-activating protein-binding protein 1
19	9606.ENSP00000220592	0.807	Protein argonaute-2
20	9606.ENSP00000470142	0.758	Regulator of nonsense transcripts 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0050789	0.979	regulation of biological process
GO:0008152	0.957	metabolic process
GO:0071704	0.950	organic substance metabolic process
GO:0044237	0.949	cellular metabolic process
GO:0050794	0.937	regulation of cellular process
GO:0044238	0.907	primary metabolic process
GO:0019222	0.907	regulation of metabolic process
GO:0006807	0.882	nitrogen compound metabolic process
GO:0060255	0.862	regulation of macromolecule metabolic process
GO:0043170	0.860	macromolecule metabolic process
GO:0051179	0.764	localization
GO:0034641	0.692	cellular nitrogen compound metabolic process
GO:1901360	0.691	organic cyclic compound metabolic process
GO:0048519	0.691	negative regulation of biological process
GO:0046483	0.672	heterocycle metabolic process
GO:0009892	0.666	negative regulation of metabolic process
GO:0010468	0.638	regulation of gene expression
GO:0006139	0.628	nucleobase-containing compound metabolic process
GO:0010605	0.601	negative regulation of macromolecule metabolic process
GO:0031323	0.593	regulation of cellular metabolic process
GO:0090304	0.578	nucleic acid metabolic process
GO:0016070	0.566	RNA metabolic process
GO:0071840	0.552	cellular component organization or biogenesis
GO:0016043	0.477	cellular component organization
GO:0051171	0.456	regulation of nitrogen compound metabolic process
GO:0010629	0.437	negative regulation of gene expression
GO:0080090	0.431	regulation of primary metabolic process
GO:0016071	0.406	mRNA metabolic process
GO:0044085	0.396	cellular component biogenesis
GO:0044265	0.396	cellular macromolecule catabolic process
GO:0022607	0.378	cellular component assembly
GO:0048522	0.364	positive regulation of cellular process
GO:0031326	0.347	regulation of cellular biosynthetic process
GO:0051246	0.340	regulation of protein metabolic process
GO:0006401	0.337	RNA catabolic process
GO:0010556	0.325	regulation of macromolecule biosynthetic process
GO:0019219	0.311	regulation of nucleobase-containing compound metabolic process
GO:0009893	0.305	positive regulation of metabolic process
GO:0006402	0.304	mRNA catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0016020	0.999	membrane
GO:0005654	0.999	nucleoplasm
GO:0036464	0.998	cytoplasmic ribonucleoprotein granule
GO:0000932	0.989	P-body
GO:0032991	0.477	protein-containing complex
GO:0012505	0.358	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]