StarFunc result for job id Q6P2H3

User Input

>input (762 residues)
MAMQEKYPTEGISHVTSPSSDVIQKGSSLGTEWQTPVISEPFRSRFSRCSSVADSGDTAI
GTSCSDIAEDFCSSSGSPPFQPIKSHVTIPTAHVMPSTLGTSPAKPNSTPVGPSSSKLPL
SGLAESVGMTRNGDLGAMKHSPGLSRDLMYFSGATGENGIEQSWFPAVGHERQEEARKFD
IPSMESTLNQSAMMETLYSDPHHRVRFHNPRTSTSKELYRVLPEAKKAPGSGAVFERNGP
HSNSSGVLPLGLQPAPGLSKPLPSQVWQPSPDTWHPREQSCELSTCRQQLELIRLQMEQM
QLQNGAICHHPAAFGPSLPILEPAQWISILNSNEHLLKEKELLIDKQRKHISQLEQKVRE
SELQVHSALLGRPAPFGDVCLLRLQELQRENTFLRAQFAQKTEALSREKIDLEKKLSASE
VEVQLIRESLKVALQKHSEEVKKQEERVKGRDKHINNLKKKCQKESEQNREKQQRIETLE
RYLADLPTLEDHQKQSQQLKDSELKSTELQEKVTELESLLEETQAICREKEIQLESLRQR
EAEFSSAGHSLQDKQSVEETSGEGPEVEMESWQKRYDSLQKIVEKQQQKMDQLRSQVQSL
EQEVAQEEGTSQALREEAQRRDSALQQLRTAVKELSVQNQDLIEKNLTLQEHLRQAQPGS
PPSPDTAQLALELHQELASCLQDLQAVCSIVTQRAQGHDPNLSLLLGIHSAQHPETQLDL
QKPDVIKRKLEEVQQLRRDIEDLRTTMSDRYAQDMGENCVTQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6P2H3	1.000	1.000	1.417E-99	762	1.000	1.000	Q6P2H3.pdb.gz	CEP85_HUMAN Centrosomal protein of 85 kDa OS=Homo sapiens OX=9606 GN=CEP85 PE=1 SV=1
2	AFDB:Q5SZL2	0.174	0.165	3.741E-28	805	0.325	0.308	Q5SZL2.pdb.gz	CE85L_HUMAN Centrosomal protein of 85 kDa-like OS=Homo sapiens OX=9606 GN=CEP85L PE=1 SV=1
3	AFDB:Q08581	0.115	0.107	2.007E-8	821	0.159	0.147	Q08581.pdb.gz	SLK19_YEAST Kinetochore protein SLK19 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SLK19 PE=1 SV=1
4	AFDB:Q4G0X9	0.135	0.095	2.274E-8	1142	0.143	0.095	Q4G0X9.pdb.gz	CCD40_HUMAN Coiled-coil domain-containing protein 40 OS=Homo sapiens OX=9606 GN=CCDC40 PE=1 SV=2
5	AFDB:B9EK46	0.114	0.081	2.576E-8	1203	0.180	0.114	B9EK46.pdb.gz	B9EK46_HUMAN Cingulin OS=Homo sapiens OX=9606 GN=CGN PE=1 SV=1
6	AFDB:Q3UHU5	0.082	0.037	1.385E-7	1945	0.167	0.065	Q3UHU5.pdb.gz	MTCL1_MOUSE Microtubule cross-linking factor 1 OS=Mus musculus OX=10090 GN=Mtcl1 PE=1 SV=1
7	AFDB:Q8CFC9	0.147	0.180	1.385E-7	601	0.155	0.196	Q8CFC9.pdb.gz	LZTS1_RAT Leucine zipper putative tumor suppressor 1 OS=Rattus norvegicus OX=10116 GN=Lzts1 PE=1 SV=3
8	AFDB:E2JKZ0	0.107	0.062	1.475E-7	1351	0.136	0.077	E2JKZ0.pdb.gz	E2JKZ0_CAEEL Dynactin subunit 1 OS=Caenorhabditis elegans OX=6239 GN=dnc-1 PE=1 SV=1
9	AFDB:Q91YU6	0.100	0.110	1.778E-7	671	0.156	0.177	Q91YU6.pdb.gz	LZTS2_MOUSE Leucine zipper putative tumor suppressor 2 OS=Mus musculus OX=10090 GN=Lzts2 PE=1 SV=3
10	AFDB:Q7TME2	0.140	0.100	2.143E-7	1165	0.193	0.126	Q7TME2.pdb.gz	SPAG5_MOUSE Sperm-associated antigen 5 OS=Mus musculus OX=10090 GN=Spag5 PE=1 SV=1
11	PDB:7rroB0	0.074	0.217	2.110	189	0.037	0.148	7rroB0.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
12	PDB:5ganG	0.047	0.093	3.264	318	0.025	0.060	5ganG.pdb.gz	Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
13	PDB:5svaS	0.056	0.253	3.474	109	0.013	0.092	5svaS.pdb.gz	Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.
14	PDB:4gwpD	0.064	0.307	3.698	121	0.008	0.050	4gwpD.pdb.gz
15	PDB:6cnnA	0.060	0.111	4.188	360	0.018	0.039	6cnnA.pdb.gz	Activation mechanism of a human SK-calmodulin channel complex elucidated by cryo-EM structures.
16	PDB:6rlbD	0.054	0.086	5.049	446	0.016	0.027	6rlbD.pdb.gz
17	PDB:4h54A	0.049	0.115	5.374	274	0.021	0.058	4h54A.pdb.gz	Structure and signaling mechanism of a zinc-sensory diguanylate cyclase.
18	PDB:7u7nD	0.056	0.180	7.339	191	0.028	0.110	7u7nD.pdb.gz
19	PDB:7fd4B	0.080	0.078	7.811	779	0.022	0.022	7fd4B.pdb.gz	Complete three-dimensional structures of the Lon protease translocating a protein substrate.
20	PDB:4cejA	0.060	0.042	8.847	1177	0.017	0.011	4cejA.pdb.gz	Structural Basis for Translocation by Addab Helicase-Nuclease and its Arrest at Chi Sites.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H7BZW2	0.0	849	435	0.570	0.998	H7BZW2_HUMAN Centrosomal protein 85 (Fragment) OS=Homo sapiens OX=9606 GN=CEP85 PE=1 SV=1
2	Q6P2H3	0.0	1551	762	1.000	1.000	CEP85_HUMAN Centrosomal protein of 85 kDa OS=Homo sapiens OX=9606 GN=CEP85 PE=1 SV=1
3	Q5SZL2	6.02e-101	331	805	0.364	0.344	CE85L_HUMAN Centrosomal protein of 85 kDa-like OS=Homo sapiens OX=9606 GN=CEP85L PE=1 SV=1
4	Q8IDX6	1.67e-04	47.8	3130	0.064	0.016	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
5	Q8INC3	1.79e-04	47.8	2194	0.093	0.032	Q8INC3_DROME Myosin heavy chain-like, isoform B OS=Drosophila melanogaster OX=7227 GN=Mhcl PE=3 SV=2
6	Q9VEZ0	2.36e-04	47.4	2148	0.093	0.033	Q9VEZ0_DROME Myosin heavy chain-like, isoform A OS=Drosophila melanogaster OX=7227 GN=Mhcl PE=3 SV=3
7	Q0KI67	2.42e-04	47.4	2160	0.093	0.033	Q0KI67_DROME Myosin heavy chain-like, isoform G OS=Drosophila melanogaster OX=7227 GN=Mhcl PE=3 SV=1
8	Q0KI66	2.63e-04	47.0	1923	0.093	0.037	Q0KI66_DROME Myosin heavy chain-like, isoform F OS=Drosophila melanogaster OX=7227 GN=Mhcl PE=3 SV=1
9	Q7K523	2.88e-04	47.0	2028	0.093	0.035	Q7K523_DROME GH15471p OS=Drosophila melanogaster OX=7227 GN=Mhcl PE=2 SV=1
10	P24043	0.003	43.9	3122	0.130	0.032	LAMA2_HUMAN Laminin subunit alpha-2 OS=Homo sapiens OX=9606 GN=LAMA2 PE=1 SV=4
11	P28023	0.007	42.4	1280	0.091	0.054	DCTN1_RAT Dynactin subunit 1 OS=Rattus norvegicus OX=10116 GN=Dctn1 PE=1 SV=2
12	Q6ZMI0	0.011	41.6	780	0.042	0.041	PPR21_HUMAN Protein phosphatase 1 regulatory subunit 21 OS=Homo sapiens OX=9606 GN=PPP1R21 PE=1 SV=1
13	Q8INC1	0.015	41.2	1134	0.097	0.065	Q8INC1_DROME Myosin heavy chain-like, isoform D OS=Drosophila melanogaster OX=7227 GN=Mhcl PE=4 SV=1
14	P53564	0.018	41.2	1515	0.117	0.059	CUX1_MOUSE Homeobox protein cut-like 1 OS=Mus musculus OX=10090 GN=Cux1 PE=1 SV=3
15	E7EX90	0.019	41.2	1256	0.087	0.053	E7EX90_HUMAN Dynactin subunit 1 OS=Homo sapiens OX=9606 GN=DCTN1 PE=1 SV=1
16	O08788	0.019	41.2	1281	0.087	0.052	DCTN1_MOUSE Dynactin subunit 1 OS=Mus musculus OX=10090 GN=Dctn1 PE=1 SV=3
17	A0A0B4KGR6	0.020	40.8	1113	0.067	0.046	A0A0B4KGR6_DROME Myosin heavy chain-like, isoform I OS=Drosophila melanogaster OX=7227 GN=Mhcl PE=4 SV=1
18	Q14203	0.021	40.8	1278	0.087	0.052	DCTN1_HUMAN Dynactin subunit 1 OS=Homo sapiens OX=9606 GN=DCTN1 PE=1 SV=3
19	P53565	0.022	40.8	1504	0.115	0.059	CUX1_RAT Homeobox protein cut-like 1 OS=Rattus norvegicus OX=10116 GN=Cux1 PE=1 SV=2
20	Q5VU43	0.045	40.0	2346	0.092	0.030	MYOME_HUMAN Myomegalin OS=Homo sapiens OX=9606 GN=PDE4DIP PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11559 ADIP	13	17.4	Afadin- and alpha -actinin-Binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000252992

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356172	0.858	Transcription factor SOX-13
2	9606.ENSP00000427550	0.831	Centrosomal protein of 192 kDa
3	9606.ENSP00000255674	0.752	Rotatin
4	9606.ENSP00000398273	0.734	Transcription factor SOX-5
5	9606.ENSP00000287482	0.720	Spindle assembly abnormal protein 6 homolog
6	9606.ENSP00000370337	0.675	Centrosomal protein of 152 kDa
7	9606.ENSP00000324729	0.616	Protein salvador homolog 1
8	9606.ENSP00000246151	0.611	Promotes megakaryocyte differentiation by up-regulating RUNX1 expression . Regulates RUNX1 expression by activating the proximal promoter of the RUNX1 gene and by enhancing the translation activity of an internal ribosome entry site (IRES) element in the RUNX1 gene
9	9606.ENSP00000331298	0.579	UBA-like domain-containing protein 2
10	9606.ENSP00000373827	0.577	Coiled-coil domain containing 150
11	9606.ENSP00000313500	0.576	Uncharacterized protein C17orf53
12	9606.ENSP00000305892	0.560	Transmembrane protein 208
13	9606.ENSP00000306760	0.553	Leucine-rich repeat-containing protein 45
14	9606.ENSP00000391942	0.552	Adaptin ear-binding coat-associated protein 2
15	9606.ENSP00000367498	0.547	Leucine-rich repeat-containing protein 47
16	9606.ENSP00000270708	0.545	WD repeat-containing protein WRAP73
17	9606.ENSP00000239830	0.541	Coiled-coil domain containing 77
18	9606.ENSP00000345528	0.535	Solute carrier family 35 member F6
19	9606.ENSP00000354553	0.535	Glycosylated lysosomal membrane protein
20	9606.ENSP00000361518	0.535	Leucine-rich repeat-containing protein 73

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.991	regulation of cellular process
GO:0031323	0.980	regulation of cellular metabolic process
GO:0051338	0.979	regulation of transferase activity
GO:0043086	0.978	negative regulation of catalytic activity
GO:0051348	0.974	negative regulation of transferase activity
GO:0051171	0.970	regulation of nitrogen compound metabolic process
GO:0031324	0.970	negative regulation of cellular metabolic process
GO:0080090	0.969	regulation of primary metabolic process
GO:0060255	0.969	regulation of macromolecule metabolic process
GO:0051248	0.960	negative regulation of protein metabolic process
GO:0019220	0.951	regulation of phosphate metabolic process
GO:0001932	0.936	regulation of protein phosphorylation
GO:0010563	0.935	negative regulation of phosphorus metabolic process
GO:0031400	0.932	negative regulation of protein modification process
GO:0033673	0.932	negative regulation of kinase activity
GO:0001933	0.917	negative regulation of protein phosphorylation
GO:0045859	0.916	regulation of protein kinase activity
GO:0006469	0.904	negative regulation of protein kinase activity
GO:0051726	0.889	regulation of cell cycle
GO:0009987	0.827	cellular process
GO:0010564	0.543	regulation of cell cycle process
GO:0071840	0.446	cellular component organization or biogenesis
GO:0016043	0.426	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005813	1.000	centrosome
GO:0031981	0.999	nuclear lumen
GO:0012505	0.996	endomembrane system
GO:0005794	0.986	Golgi apparatus
GO:0005730	0.979	nucleolus
GO:0000242	0.961	pericentriolar material
GO:0005819	0.878	spindle
GO:0005654	0.754	nucleoplasm
GO:0000922	0.686	spindle pole

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]