StarFunc result for job id Q6P2H8

User Input

>input (277 residues)
MASAELDYTIEIPDQPCWSQKNSPSPGGKEAETRQPVVILLGWGGCKDKNLAKYSAIYHK
RGCIVIRYTAPWHMVFFSESLGIPSLRVLAQKLLELLFDYEIEKEPLLFHVFSNGGVMLY
RYVLELLQTRRFCRLRVVGTIFDSAPGDSNLVGALRALAAILERRAAMLRLLLLVAFALV
VVLFHVLLAPITALFHTHFYDRLQDAGSRWPELYLYSRADEVVLARDIERMVEARLARRV
LARSVDFVSSAHVSHLRDYPTYYTSLCVDFMRNCVRC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6P2H8	1.000	1.000	1.925E-56	277	1.000	1.000	Q6P2H8.pdb.gz	TMM53_HUMAN Transmembrane protein 53 OS=Homo sapiens OX=9606 GN=TMEM53 PE=2 SV=1
2	AFDB:Q9D0Z3	0.951	0.954	4.054E-49	276	0.866	0.870	Q9D0Z3.pdb.gz	TMM53_MOUSE Transmembrane protein 53 OS=Mus musculus OX=10090 GN=Tmem53 PE=1 SV=1
3	AFDB:Q54YR8	0.764	0.782	2.787E-18	270	0.256	0.263	Q54YR8.pdb.gz	Q54YR8_DICDI Transmembrane protein 53 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0278115 PE=3 SV=1
4	AFDB:Q9TZH8	0.733	0.633	4.726E-17	325	0.245	0.209	Q9TZH8.pdb.gz	Q9TZH8_CAEEL Transmembrane protein 53 OS=Caenorhabditis elegans OX=6239 GN=CELE_T10B11.6 PE=1 SV=1
5	AFDB:Q9FFG7	0.677	0.480	1.423E-13	403	0.195	0.134	Q9FFG7.pdb.gz	Q9FFG7_ARATH At5g44250 OS=Arabidopsis thaliana OX=3702 GN=MLN1.18 PE=1 SV=1
6	AFDB:Q7K274	0.682	0.499	1.321E-12	389	0.152	0.108	Q7K274.pdb.gz	Q7K274_DROME LD15586p OS=Drosophila melanogaster OX=7227 GN=l(2)k09913 PE=1 SV=1
7	AFDB:O35678	0.562	0.519	9.113E-8	303	0.152	0.139	O35678.pdb.gz	MGLL_MOUSE Monoglyceride lipase OS=Mus musculus OX=10090 GN=Mgll PE=1 SV=1
8	PDB:6fvjD	0.507	0.611	1.028E-7	223	0.141	0.175	6fvjD.pdb.gz	Biochemical and Structural Characterization of TesA, a Major Thioesterase Required for Outer-Envelope Lipid Biosynthesis in Mycobacterium tuberculosis.
9	PDB:4kryE	0.466	0.405	1.664E-7	329	0.119	0.100	4kryE.pdb.gz
10	AFDB:A4IJ41	0.511	0.323	2.389E-7	466	0.188	0.112	A4IJ41.pdb.gz	A4IJ41_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At3g10840 PE=1 SV=1
11	AFDB:Q9LFQ7	0.475	0.414	2.862E-7	327	0.148	0.125	Q9LFQ7.pdb.gz	Q9LFQ7_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=MAGL14 PE=1 SV=1
12	AFDB:Q57Y40	0.587	0.532	3.039E-7	310	0.144	0.129	Q57Y40.pdb.gz	Q57Y40_TRYB2 Monoglyceride lipase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.1D20.80 PE=4 SV=1
13	PDB:7prmA	0.570	0.539	4.361E-7	295	0.126	0.119	7prmA.pdb.gz	Development of High Brain-Penetrant and Reversible Monoacylglycerol Lipase PET Tracers for Neuroimaging.
14	PDB:3e3aB	0.486	0.489	7.965E-7	275	0.119	0.120	3e3aB.pdb.gz
15	PDB:2ocgA	0.506	0.546	2.088E-6	254	0.130	0.142	2ocgA.pdb.gz	Molecular basis of prodrug activation by human valacyclovirase, an alpha-amino acid ester hydrolase.
16	PDB:6y0fC	0.562	0.240	2.355E-6	722	0.119	0.046	6y0fC.pdb.gz	Structure of human FAPalpha in complex with linagliptin
17	PDB:1m33A	0.519	0.555	2.501E-6	256	0.152	0.164	1m33A.pdb.gz	Integrating structure, bioinformatics, and enzymology to discover function: BioH, a new carboxylesterase from Escherichia coli.
18	PDB:4g8bA	0.487	0.487	3.380E-6	277	0.130	0.130	4g8bA.pdb.gz	High-resolution structures of AidH complexes provide insights into a novel catalytic mechanism for N-acyl homoserine lactonase
19	PDB:1u2eA	0.511	0.497	3.813E-6	286	0.159	0.154	1u2eA.pdb.gz
20	PDB:5jzsB	0.512	0.500	5.812E-6	284	0.155	0.151	5jzsB.pdb.gz	Investigation of the mycobacterial enzyme HsaD as a potential novel target for anti-tubercular agents using a fragment-based drug design approach.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6P2H8	0.0	567	277	1.000	1.000	TMM53_HUMAN Transmembrane protein 53 OS=Homo sapiens OX=9606 GN=TMEM53 PE=2 SV=1
2	Q9D0Z3	3.31e-165	460	276	0.866	0.870	TMM53_MOUSE Transmembrane protein 53 OS=Mus musculus OX=10090 GN=Tmem53 PE=1 SV=1
3	Q9TZH8	4.80e-21	92.8	325	0.245	0.209	Q9TZH8_CAEEL Transmembrane protein 53 OS=Caenorhabditis elegans OX=6239 GN=CELE_T10B11.6 PE=1 SV=1
4	Q54YR8	2.33e-19	87.4	270	0.260	0.267	Q54YR8_DICDI Transmembrane protein 53 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0278115 PE=3 SV=1
5	Q7K274	1.39e-05	48.1	389	0.191	0.136	Q7K274_DROME LD15586p OS=Drosophila melanogaster OX=7227 GN=l(2)k09913 PE=1 SV=1
6	Q9FFG7	0.007	40.0	403	0.195	0.134	Q9FFG7_ARATH At5g44250 OS=Arabidopsis thaliana OX=3702 GN=MLN1.18 PE=1 SV=1
7	Q9NQR4	1.3	32.7	276	0.061	0.062	NIT2_HUMAN Omega-amidase NIT2 OS=Homo sapiens OX=9606 GN=NIT2 PE=1 SV=1
8	V9HW91	1.3	32.7	276	0.061	0.062	V9HW91_HUMAN Epididymis secretory sperm binding protein Li 8a OS=Homo sapiens OX=9606 GN=HEL-S-8a PE=2 SV=1
9	Q9JHW2	1.4	32.7	276	0.061	0.062	NIT2_MOUSE Omega-amidase NIT2 OS=Mus musculus OX=10090 GN=Nit2 PE=1 SV=1
10	P9WF73	6.3	29.6	124	0.065	0.145	VPC32_MYCTU Ribonuclease VapC32 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=vapC32 PE=1 SV=1
11	P29374	6.8	30.8	1257	0.069	0.015	ARI4A_HUMAN AT-rich interactive domain-containing protein 4A OS=Homo sapiens OX=9606 GN=ARID4A PE=1 SV=3
12	F8VPQ2	8.2	30.4	1261	0.069	0.015	ARI4A_MOUSE AT-rich interactive domain-containing protein 4A OS=Mus musculus OX=10090 GN=Arid4a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05705 DUF829	7.9e-49	178.3	Eukaryotic protein of unknown function (DUF829)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361311

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000215906	0.797	Aspartate beta-hydroxylase domain-containing protein 2
2	9606.ENSP00000361331	0.748	ERI1 exoribonuclease family member 3
3	9606.ENSP00000347548	0.747	E3 ubiquitin-protein ligase RNF220
4	9606.ENSP00000356567	0.737	Acyl-CoA-binding domain-containing protein 6
5	9606.ENSP00000414055	0.736	Nuclear receptor-binding protein 2
6	9606.ENSP00000434359	0.726	Poly(U)-binding-splicing factor PUF60
7	9606.ENSP00000484472	0.723	Epiplakin
8	9606.ENSP00000356737	0.718	Golgin, RAB6 interacting
9	9606.ENSP00000420716	0.650	Uncharacterized protein C1orf228
10	9606.ENSP00000355587	0.639	Cancer-related nucleoside-triphosphatase
11	9606.ENSP00000333519	0.631	Sodium/potassium/calcium exchanger 3
12	9606.ENSP00000356785	0.630	Nucleoside diphosphate kinase 7
13	9606.ENSP00000381928	0.626	Protein MGARP
14	9606.ENSP00000362207	0.619	Carbohydrate sulfotransferase 3
15	9606.ENSP00000440374	0.614	Guanine nucleotide exchange factor DBS
16	9606.ENSP00000361363	0.607	DNA methyltransferase 1-associated protein 1
17	9606.ENSP00000343002	0.605	Beta-1,3-glucosyltransferase
18	9606.ENSP00000380747	0.604	Transmembrane protein 209
19	9606.ENSP00000246117	0.601	Nicalin
20	9606.ENSP00000376565	0.596	Transmembrane and ubiquitin-like domain-containing protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016787	1.000	hydrolase activity
GO:0005515	0.999	protein binding
GO:0016788	0.583	hydrolase activity, acting on ester bonds
GO:0052689	0.300	carboxylic ester hydrolase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.991	regulation of cellular process
GO:0048583	0.982	regulation of response to stimulus
GO:0023051	0.936	regulation of signaling
GO:0010646	0.936	regulation of cell communication
GO:0030278	0.907	regulation of ossification
GO:0009966	0.880	regulation of signal transduction
GO:0048519	0.877	negative regulation of biological process
GO:0046822	0.866	regulation of nucleocytoplasmic transport
GO:0048523	0.864	negative regulation of cellular process
GO:0030514	0.828	negative regulation of BMP signaling pathway
GO:0030279	0.817	negative regulation of ossification

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031965	0.999	nuclear membrane
GO:0005737	0.732	cytoplasm
GO:0042175	0.439	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0098588	0.396	bounding membrane of organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	1.000	Hydrolases.
EC:3.1.-.-	0.583	Acting on ester bonds.
EC:3.1.1.-	0.300	Carboxylic ester hydrolases.

[back to server]