StarFunc result for job id Q6P2Q9

User Input

>input (2335 residues)
MAGVFPYRGPGNPVPGPLAPLPDYMSEEKLQEKARKWQQLQAKRYAEKRKFGFVDAQKED
MPPEHVRKIIRDHGDMTNRKFRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVPVLY
HITGAISFVNEIPWVIEPVYISQWGSMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYAD
NILDVEPLEAIQLELDPEEDAPVLDWFYDHQPLRDSRKYVNGSTYQRWQFTLPMMSTLYR
LANQLLTDLVDDNYFYLFDLKAFFTSKALNMAIPGGPKFEPLVRDINLQDEDWNEFNDIN
KIIIRQPIRTEYKIAFPYLYNNLPHHVHLTWYHTPNVVFIKTEDPDLPAFYFDPLINPIS
HRHSVKSQEPLPDDDEEFELPEFVEPFLKDTPLYTDNTANGIALLWAPRPFNLRSGRTRR
ALDIPLVKNWYREHCPAGQPVKVRVSYQKLLKYYVLNALKHRPPKAQKKRYLFRSFKATK
FFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRF
GNAFHLCREVLRLTKLVVDSHVQYRLGNVDAFQLADGLQYIFAHVGQLTGMYRYKYKLMR
QIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAAGWRVWLFFMRGITPLLERWLGNLLARQF
EGRHSKGVAKTVTKQRVESHFDLELRAAVMHDILDMMPEGIKQNKARTILQHLSEAWRCW
KANIPWKVPGLPTPIENMILRYVKAKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLT
RLYLKAEQERQHNYLKDGPYITAEEAVAVYTTTVHWLESRRFSPIPFPPLSYKHDTKLLI
LALERLKEAYSVKSRLNQSQREELGLIEQAYDNPHEALSRIKRHLLTQRAFKEVGIEFMD
LYSHLVPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPADTEPPPLLVYKWCQGIN
NLQDVWETSEGECNVMLESRFEKMYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYK
DMNHTNSYGIIRGLQFASFIVQYYGLVMDLLVLGLHRASEMAGPPQMPNDFLSFQDIATE
AAHPIRLFCRYIDRIHIFFRFTADEARDLIQRYLTEHPDPNNENIVGYNNKKCWPRDARM
RLMKHDVNLGRAVFWDIKNRLPRSVTTVQWENSFVSVYSKDNPNLLFNMCGFECRILPKC
RTSYEEFTHKDGVWNLQNEVTKERTAQCFLRVDDESMQRFHNRVRQILMASGSTTFTKIV
NKWNTALIGLMTYFREAVVNTQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPK
ELGGLGMLSMGHVLIPQSDLRWSKQTDVGITHFRSGMSHEEDQLIPNLYRYIQPWESEFI
DSQRVWAEYALKRQEAIAQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRT
DFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEG
LFWEKASGFEESMKWKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGI
FMHGKIPTLKISLIQIFRAHLWQKIHESIVMDLCQVFDQELDALEIETVQKETIHPRKSY
KMNSSCADILLFASYKWNVSRPSLLADSKDVMDSTTTQKYWIDIQLRWGDYDSHDIERYA
RAKFLDYTTDNMSIYPSPTGVLIAIDLAYNLHSAYGNWFPGSKPLIQQAMAKIMKANPAL
YVLRERIRKGLQLYSSEPTEPYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTT
KPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQ
IIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLY
DDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVE
VQLKDLILADYGKKNNVNVASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQTKEQSQLT
ATQTRTVNKHGDEIITSTTSNYETQTFSSKTEWRVRAISAANLHLRTNHIYVSSDDIKET
GYTYILPKNVLKKFICISDLRAQIAGYLYGVSPPDNPQVKEIRCIVMVPQWGTHQTVHLP
GQLPQHEYLKEMEPLGWIHTQPNESPQLSPQDVTTHAKIMADNPSWDGEKTIIITCSFTP
GSCTLTAYKLTPSGYEWGRQNTDKGNNPKGYLPSHYERVQMLLSDRFLGFFMVPAQSSWN
YNFMGVRHDPNMKYELQLANPKEFYHEVHRPSHFLNFALLQEGEVYSADREDLYA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:3jb9A	0.742	0.876	0.000	1964	0.650	0.772	3jb9A.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
2	PDB:5ganA	0.534	0.561	0.000	2196	0.600	0.638	5ganA.pdb.gz	Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
3	PDB:5gm6A	0.701	0.743	0.000	2200	0.602	0.639	5gm6A.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
4	PDB:5lqwA	0.673	0.736	0.000	2130	0.588	0.644	5lqwA.pdb.gz	Molecular architecture of the Saccharomyces cerevisiae activated spliceosome
5	PDB:5nrlA	0.545	0.570	0.000	2216	0.604	0.637	5nrlA.pdb.gz	Structure of a pre-catalytic spliceosome.
6	PDB:5z56A	0.724	0.756	0.000	2232	0.955	0.999	5z56A.pdb.gz	Structure of the human activated spliceosome in three conformational states.
7	PDB:5z57A	0.726	0.857	0.000	1978	0.846	0.999	5z57A.pdb.gz	Structure of the human activated spliceosome in three conformational states.
8	PDB:6iczA	0.735	0.762	0.000	2253	0.964	0.999	6iczA.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
9	PDB:6j6gA	0.715	0.871	0.000	1913	0.544	0.664	6j6gA.pdb.gz	Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.
10	PDB:6qw65A	0.500	0.525	0.000	2212	0.946	0.999	6qw65A.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
11	AFDB:A1Z8U0	0.744	0.725	0.000	2396	0.913	0.890	A1Z8U0.pdb.gz	A1Z8U0_DROME Pre-mRNA processing factor 8 OS=Drosophila melanogaster OX=7227 GN=Prp8 PE=1 SV=1
12	AFDB:O14187	0.740	0.731	0.000	2363	0.737	0.729	O14187.pdb.gz	SPP42_SCHPO Pre-mRNA-splicing factor spp42 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spp42 PE=1 SV=1
13	AFDB:P33334	0.733	0.709	0.000	2413	0.615	0.595	P33334.pdb.gz	PRP8_YEAST Pre-mRNA-splicing factor 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRP8 PE=1 SV=1
14	AFDB:Q38DR4	0.727	0.707	0.000	2403	0.415	0.404	Q38DR4.pdb.gz	Q38DR4_TRYB2 PRP8 protein homologue OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.2420 PE=4 SV=1
15	AFDB:Q9SSD2	0.749	0.741	0.000	2359	0.830	0.821	Q9SSD2.pdb.gz	PRP8A_ARATH Pre-mRNA-processing-splicing factor 8A OS=Arabidopsis thaliana OX=3702 GN=PRP8A PE=1 SV=1
16	AFDB:Q4FZS3	0.114	0.637	3.909E-57	410	0.175	0.995	Q4FZS3.pdb.gz	Q4FZS3_RAT Prpf8 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Prpf8 PE=2 SV=1
17	AFDB:Q6XZF7	0.042	0.056	1.903E-1	1577	0.039	0.057	Q6XZF7.pdb.gz	DNMBP_HUMAN Dynamin-binding protein OS=Homo sapiens OX=9606 GN=DNMBP PE=1 SV=1
18	AFDB:F1LNP1	0.038	0.045	2.457E-1	1751	0.038	0.050	F1LNP1.pdb.gz	F1LNP1_RAT AT-rich interaction domain 1B OS=Rattus norvegicus OX=10116 GN=Arid1b PE=1 SV=3
19	AFDB:B3DKN2	0.037	0.115	5.286E-1	537	0.021	0.089	B3DKN2.pdb.gz	B3DKN2_DANRE Nr5a5 protein OS=Danio rerio OX=7955 GN=fd46g06 PE=2 SV=1
20	AFDB:Q6ZSS7	0.036	0.066	7.752E-1	791	0.039	0.114	Q6ZSS7.pdb.gz	MFSD6_HUMAN Major facilitator superfamily domain-containing protein 6 OS=Homo sapiens OX=9606 GN=MFSD6 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K5V6	0.0	4794	2317	0.988	0.995	A0A0G2K5V6_RAT Pre-mRNA processing factor 8 OS=Rattus norvegicus OX=10116 GN=Prpf8 PE=1 SV=1
2	A1Z8U0	0.0	4442	2396	0.914	0.891	A1Z8U0_DROME Pre-mRNA processing factor 8 OS=Drosophila melanogaster OX=7227 GN=Prp8 PE=1 SV=1
3	G3V6H2	0.0	4871	2335	0.999	0.999	G3V6H2_RAT Pre-mRNA processing factor 8 OS=Rattus norvegicus OX=10116 GN=Prpf8 PE=4 SV=1
4	O14187	0.0	3624	2363	0.735	0.727	SPP42_SCHPO Pre-mRNA-splicing factor spp42 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spp42 PE=1 SV=1
5	P33334	0.0	3059	2413	0.621	0.601	PRP8_YEAST Pre-mRNA-splicing factor 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRP8 PE=1 SV=1
6	Q38DR4	0.0	1859	2403	0.419	0.407	Q38DR4_TRYB2 PRP8 protein homologue OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.2420 PE=4 SV=1
7	Q4FZS3	0.0	853	410	0.175	0.995	Q4FZS3_RAT Prpf8 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Prpf8 PE=2 SV=1
8	Q4WI55	0.0	1261	3170	0.263	0.194	Q4WI55_ASPFU Pre-mRNA splicing factor (Prp8), putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_2G03030 PE=4 SV=1
9	Q6P2Q9	0.0	4873	2335	1.000	1.000	PRP8_HUMAN Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens OX=9606 GN=PRPF8 PE=1 SV=2
10	Q960V2	0.0	2579	1328	0.532	0.935	Q960V2_DROME LD33339p OS=Drosophila melanogaster OX=7227 GN=Prp8 PE=2 SV=1
11	Q9SSD2	0.0	4127	2359	0.824	0.816	PRP8A_ARATH Pre-mRNA-processing-splicing factor 8A OS=Arabidopsis thaliana OX=3702 GN=PRP8A PE=1 SV=1
12	Q9T0I6	0.0	4028	2359	0.809	0.801	PRP8B_ARATH Pre-mRNA-processing-splicing factor 8B OS=Arabidopsis thaliana OX=3702 GN=PRP8B PE=3 SV=2
13	Q9CQ26	1.5	36.2	424	0.012	0.064	STABP_MOUSE STAM-binding protein OS=Mus musculus OX=10090 GN=Stambp PE=1 SV=1
14	A0A140VK54	2.7	35.4	424	0.011	0.061	A0A140VK54_HUMAN Testicular secretory protein Li 54 OS=Homo sapiens OX=9606 PE=2 SV=1
15	O95630	2.7	35.4	424	0.011	0.061	STABP_HUMAN STAM-binding protein OS=Homo sapiens OX=9606 GN=STAMBP PE=1 SV=1
16	G0SDN1	3.6	35.4	1029	0.006	0.015	G0SDN1_CHATD FACT complex subunit OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=CTHT_0052370 PE=1 SV=1
17	Q9LYN2	3.9	34.7	259	0.015	0.139	FRI3_ARATH Ferritin-3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FER3 PE=1 SV=1
18	Q6NLV4	4.1	35.0	647	0.011	0.039	FY_ARATH Flowering time control protein FY OS=Arabidopsis thaliana OX=3702 GN=FY PE=1 SV=1
19	Q96FJ0	5.0	34.7	436	0.012	0.064	STALP_HUMAN AMSH-like protease OS=Homo sapiens OX=9606 GN=STAMBPL1 PE=1 SV=2
20	Q9UKG9	7.0	34.3	612	0.014	0.052	OCTC_HUMAN Peroxisomal carnitine O-octanoyltransferase OS=Homo sapiens OX=9606 GN=CROT PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01398 JAB	5.3e-10	50.7	JAB1/Mov34/MPN/PAD-1 ubiquitin protease
2	PF08082 PRO8NT	2.6e-82	285.7	PRO8NT (NUC069), PrP8 N-terminal domain
3	PF08083 PROCN	8.5e-231	777.4	PROCN (NUC071) domain
4	PF08084 PROCT	6.1e-49	176.4	PROCT (NUC072) domain
5	PF12134 PRP8_domainIV	5.5e-126	430.3	PRP8 domain IV core
6	PF10598 RRM_4	1.3e-44	161.8	RNA recognition motif of the spliceosomal PrP8
7	PF10597 U5_2-snRNA_bdg	1.2e-69	244.0	U5-snRNA binding site 2 of PrP8
8	PF10596 U6-snRNA_bdg	6.4e-86	297.7	U6-snRNA interacting domain of PrP8

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 885580.XP_010640457.1

Rank	PPI partner	STRING score	Description
1	885580.XP_010619915.1	0.999	U5 small nuclear ribonucleoprotein 40 kDa protein
2	885580.XP_010630264.1	0.999	Splicing factor 3B subunit 1 isoform X1
3	885580.XP_010631726.1	0.999	pre-mRNA-processing factor 6
4	885580.XP_010636444.1	0.999	U5 small nuclear ribonucleoprotein 200 kDa helicase
5	885580.XP_010641231.1	0.999	116 kDa U5 small nuclear ribonucleoprotein component
6	885580.XP_010602210.1	0.998	Small nuclear ribonucleoprotein Sm D3
7	885580.XP_010614696.1	0.998	U4/U6 small nuclear ribonucleoprotein Prp3
8	885580.XP_010615264.1	0.998	U4/U6 small nuclear ribonucleoprotein Prp31
9	885580.XP_010616042.1	0.998	Cell division cycle 5-like protein
10	885580.XP_010631351.1	0.998	Pre-mRNA-processing factor 19
11	885580.XP_010632480.1	0.998	Crooked neck-like protein 1
12	885580.XP_010633187.1	0.998	Splicing factor 3A subunit 2
13	885580.XP_010637679.1	0.998	U4/U6 small nuclear ribonucleoprotein Prp4
14	885580.XP_010642740.1	0.998	Splicing factor 3B subunit 3
15	885580.XP_010643890.1	0.998	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 16 samples with support for all annotated introns
16	885580.XP_010604014.1	0.997	pre-mRNA-splicing factor SYF1
17	885580.XP_010612902.1	0.997	Plays role in pre-mRNA splicing as core component of the SMN- Sm complex that mediates spliceosomal snRNP assembly and as component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes. Is also a component of the minor U12 spliceosome.
18	885580.XP_010621868.1	0.997	Putative ATP-dependent RNA helicase DDX23
19	885580.XP_010625494.1	0.997	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 14 samples with support for all annotated introns
20	885580.XP_010626238.1	0.997	Pleiotropic regulator 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0003723	0.994	RNA binding
GO:0003824	0.466	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0008380	0.990	RNA splicing
GO:0000398	0.968	mRNA splicing, via spliceosome
GO:0022618	0.958	ribonucleoprotein complex assembly
GO:0000387	0.911	spliceosomal snRNP assembly
GO:0050896	0.409	response to stimulus
GO:0065007	0.344	biological regulation
GO:0050789	0.331	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1990904	0.999	ribonucleoprotein complex
GO:0140513	0.999	nuclear protein-containing complex
GO:0030532	0.990	small nuclear ribonucleoprotein complex
GO:0005737	0.989	cytoplasm
GO:0005654	0.888	nucleoplasm
GO:0016020	0.881	membrane
GO:0005681	0.864	spliceosomal complex
GO:1902494	0.690	catalytic complex
GO:0097525	0.492	spliceosomal snRNP complex
GO:0005684	0.479	U2-type spliceosomal complex
GO:0071013	0.422	catalytic step 2 spliceosome
GO:0005829	0.417	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]