StarFunc result for job id Q6P2S7

User Input

>input (1318 residues)
MSQKTNENVERYTQFLQKPQKPIQPYICSTLNDFQEERDFLANNIFPQLNELCNSWGTYF
KAVDLSWSALKAPKSLPTHLFRQYSCLRSQRLKLCLDYVNSCFPFFICMLGQTYGDFLPD
YSHFMTSKVTRLSSLSKVENLYVAAKNGYPWVLENPSCSLTEFEIIQAAFLNESQFQYFY
FRTGTTLLKALDDEKKGERLPSSSSTNEEETLRIGKLKAKIISKGLPVRFYSDLHELGEL
VFKDWSVVIEKLHPATLMIENIDYKHSFERFYHEEFTEKCKQMCVISKESDRTFEILEKF
ALKDVELDFNNVAADSSLDSVPRFFRINPTPTYKSILLLSREHGCGKSTLIANWVNYFKK
KHPSMLLIPHFVGSTCESSYIMSVIHYFITELQYRNYGTQLETDILNEDSDGLVFSFLVE
VFIASISLKPCILVLDGIEELIGIYGISGQKVKDFSWLPHSLSPHCKFIMSTVSSSLSYK
SLCARPDVRTVELISTGDEETKLNIFRKHLSIPMMDPFEQSTQALRKKPDLSPLKLTILA
NELKEYRINHNEFQCMKEYLEAVSVQELWELVLKRWIEDYSWTFQPKRANSDTVASGEGL
DSWVADALCLLCLSHGGLAEDELLQLLDMLGYRNHYKVTALHWAAFRNATKQWVQEKPNG
LLYFWHQSLSAVEHKLLGVITPVESSPCSFQTPMNHKKTHFHQVLIRYFQRQTSFWRVYQ
ELPWHMKMSGCLRGLCGFLSSPTITDFISKIQSLGFWTRLHLIHFWNVLLEAGYDVSEAY
LLSVAKIKADQCHTMRKSGTLSVLQCRLIELTVLDKCRLMFFIGSFLKFMGKTNEAEELF
LSVEDMLVQSQSMTDMLLKVQNAIGELYLETGMTQEGFQYFQKAWSSMLRLSLSDLEDSR
DLVKQKVRVLDNLAKSASEEYLKENHILEYATEISNLLDNNPRDQATMKYIEGVLMFVAG
NTSLAKMKLRECLNIRKSLFGKKNMLVGEVMEFLADLLFFPQRDSKKSQRKQVLKYYKQV
IKIKENAETLAKSSLLRKQLSISLSDTLCKLAGHLLASDSCHHVMIEAVGYLYRSVDLRV
IHLGSSHSSIHGIHGILHLLREIEWIRSRRYWPQGMSQQHSEGSRNGFSLWEHLVKLNYH
SAQSSNTVSSAMCMNADKLHRARRMDLAPQTISDKSKCAPGKGKKKPIICISAEEKIQRK
TQNNAEIWNGSGKEASKKKTDYSSNILSLGKMNGLIKLSRQRILLAKSESGEGEITTIYH
HPLPWPVSTKNPGESEFISEKWLFHSPDYISISQKSFLQRRLHIETKLLKTSNDINKE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P97499	0.288	0.165	7.129E-13	2629	0.108	0.054	P97499.pdb.gz	TEP1_MOUSE Telomerase protein component 1 OS=Mus musculus OX=10090 GN=Tep1 PE=1 SV=1
2	AFDB:A2A690	0.190	0.135	1.810E-10	1994	0.099	0.066	A2A690.pdb.gz	TANC2_MOUSE Protein TANC2 OS=Mus musculus OX=10090 GN=Tanc2 PE=1 SV=1
3	AFDB:O14607	0.183	0.180	1.243E-7	1347	0.050	0.049	O14607.pdb.gz	UTY_HUMAN Histone demethylase UTY OS=Homo sapiens OX=9606 GN=UTY PE=1 SV=2
4	AFDB:F4IAT2	0.078	0.064	4.307E-6	1823	0.123	0.089	F4IAT2.pdb.gz	THOC2_ARATH THO complex subunit 2 OS=Arabidopsis thaliana OX=3702 GN=THO2 PE=1 SV=1
5	AFDB:Q6PR54	0.097	0.074	6.947E-6	2419	0.086	0.047	Q6PR54.pdb.gz	RIF1_MOUSE Telomere-associated protein RIF1 OS=Mus musculus OX=10090 GN=Rif1 PE=1 SV=2
6	AFDB:Q5UIP0	0.088	0.060	8.478E-6	2472	0.112	0.059	Q5UIP0.pdb.gz	RIF1_HUMAN Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2
7	AFDB:Q96QP1	0.114	0.119	1.120E-5	1244	0.059	0.063	Q96QP1.pdb.gz	ALPK1_HUMAN Alpha-protein kinase 1 OS=Homo sapiens OX=9606 GN=ALPK1 PE=1 SV=3
8	AFDB:A0A0G2K6D0	0.165	0.160	1.314E-5	1366	0.065	0.063	A0A0G2K6D0.pdb.gz	A0A0G2K6D0_RAT [histone H3]-trimethyl-L-lysine(27) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm6a PE=1 SV=2
9	PDB:3sfzA	0.209	0.239	1.726E-5	1133	0.047	0.055	3sfzA.pdb.gz	Crystal structure of full-length Apaf-1: how the death signal is relayed in the mitochondrial pathway of apoptosis.
10	AFDB:Q9VW83	0.132	0.103	1.957E-5	1847	0.101	0.072	Q9VW83.pdb.gz	Q9VW83_DROME Gigas, isoform A OS=Drosophila melanogaster OX=7227 GN=gig PE=1 SV=1
11	AFDB:Q1LVF3	0.088	0.095	4.700E-5	1180	0.071	0.080	Q1LVF3.pdb.gz	SMG7_DANRE Nonsense-mediated mRNA decay factor SMG7 OS=Danio rerio OX=7955 GN=smg7 PE=2 SV=2
12	PDB:7dkhI	0.129	0.161	1.265E-4	914	0.086	0.124	7dkhI.pdb.gz
13	PDB:6bq1B	0.151	0.234	1.739E-4	728	0.071	0.128	6bq1B.pdb.gz	Architecture of the human PI4KIII alpha lipid kinase complex.
14	PDB:7r5jR0	0.081	0.078	3.424E-4	1399	0.077	0.072	7r5jR0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
15	PDB:7qe7Y	0.146	0.293	3.858E-4	502	0.045	0.118	7qe7Y.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
16	PDB:4gyoB	0.155	0.446	4.015E-4	359	0.036	0.131	4gyoB.pdb.gz	Conformational change-induced repeat domain expansion regulates rap phosphatase quorum-sensing signal receptors.
17	PDB:6j5wA	0.192	0.292	4.348E-4	816	0.049	0.080	6j5wA.pdb.gz	Ligand-triggered allosteric ADP release primes a plant NLR complex.
18	PDB:7pzcA	0.179	0.223	4.525E-4	1010	0.083	0.108	7pzcA.pdb.gz	Structure of the NLRP3 decamer bound to the cytokine release inhibitor CRID3.
19	PDB:6xu2A	0.144	0.163	1.177E-3	1091	0.062	0.075	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
20	PDB:7ay1A	0.085	0.101	1.275E-3	1033	0.096	0.123	7ay1A.pdb.gz	Structural basis of FANCD2 deubiquitination by USP1-UAF1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q99973	5.69e-11	70.1	2627	0.087	0.044	TEP1_HUMAN Telomerase protein component 1 OS=Homo sapiens OX=9606 GN=TEP1 PE=1 SV=2
2	P97499	1.71e-09	65.1	2629	0.084	0.042	TEP1_MOUSE Telomerase protein component 1 OS=Mus musculus OX=10090 GN=Tep1 PE=1 SV=1
3	O08653	7.97e-08	59.7	2629	0.083	0.042	TEP1_RAT Telomerase protein component 1 OS=Rattus norvegicus OX=10116 GN=Tep1 PE=1 SV=1
4	P0CI65	0.035	41.2	1303	0.026	0.026	NPHP3_DANRE Nephrocystin-3 OS=Danio rerio OX=7955 GN=nphp3 PE=3 SV=1
5	Q7TNH6	0.082	40.0	1325	0.016	0.016	NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus OX=10090 GN=Nphp3 PE=1 SV=2
6	Q7Z494	0.092	39.7	1330	0.016	0.016	NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens OX=9606 GN=NPHP3 PE=1 SV=1
7	Q6AZT7	0.43	37.4	1300	0.014	0.014	NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis OX=8355 GN=nphp3 PE=2 SV=1
8	Q9UQQ1	1.2	35.8	740	0.014	0.024	NALDL_HUMAN Aminopeptidase NAALADL1 OS=Homo sapiens OX=9606 GN=NAALADL1 PE=1 SV=2
9	Q382P4	2.1	35.4	1299	0.031	0.032	Q382P4_TRYB2 IF rod domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.52.0008 PE=4 SV=1
10	A1Z6W3	3.4	34.7	1299	0.017	0.018	PRIC1_DROME Protein prickle OS=Drosophila melanogaster OX=7227 GN=pk PE=1 SV=1
11	E1B8W3	9.4	33.1	1044	0.036	0.046	ODAD2_BOVIN Outer dynein arm-docking complex subunit 2 OS=Bos taurus OX=9913 GN=ODAD2 PE=1 SV=3
12	Q4JNX8	9.7	33.1	1500	0.019	0.017	Q4JNX8_XENLA RECQL4-helicase-like protein OS=Xenopus laevis OX=8355 GN=recql4.L PE=2 SV=1
13	Q33DM4	9.8	33.1	1503	0.019	0.017	Q33DM4_XENLA RecQ4 protein OS=Xenopus laevis OX=8355 GN=XRecQ4 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	1.9e+02	13.8	AAA ATPase domain
2	PF13271 DUF4062	0.048	25.4	Domain of unknown function (DUF4062)
3	PF05729 NACHT	38	15.6	NACHT domain
4	PF13424 TPR_12	4.5	18.9	Tetratricopeptide repeat
5	PF13181 TPR_8	6	18.4	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008956258.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003819041.1	0.661	Chromosome 5 open reading frame, human C5orf52
2	9597.XP_008971154.1	0.628	Sphingomyelin phosphodiesterase 3
3	9597.XP_008960874.1	0.554	Protein RoBo-1-like
4	9597.XP_008968231.1	0.542	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 1 base in 1 codon
5	9597.XP_008968919.1	0.540	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: deleted 1 base in 1 codon

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.901	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0065007	0.845	biological regulation
GO:0050789	0.796	regulation of biological process
GO:0008152	0.689	metabolic process
GO:0071704	0.672	organic substance metabolic process
GO:0044237	0.584	cellular metabolic process
GO:0032501	0.560	multicellular organismal process
GO:0050794	0.540	regulation of cellular process
GO:0044238	0.524	primary metabolic process
GO:0071840	0.496	cellular component organization or biogenesis
GO:0016043	0.456	cellular component organization
GO:0032502	0.436	developmental process
GO:0006996	0.424	organelle organization
GO:0006807	0.420	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0005634	0.879	nucleus
GO:0042995	0.613	cell projection
GO:0032991	0.443	protein-containing complex
GO:0012505	0.301	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]