StarFunc result for job id Q6P3S1

User Input

>input (775 residues)
MDCRTKANPDRTFDLVLKVKCHASENEDPVVLWKFPEDFGDQEILQSVPKFCFPFDVERV
SQNQVGQHFTFVLTDIESKQRFGFCRLTSGGTICLCILSYLPWFEVYYKLLNTLADYLAK
ELENDLNETLRSLYNHPVPKANTPVNLSVNQEIFIACEQVLKDQPALVPHSYFIAPDVTG
LPTIPESRNLTEYFVAVDVNNMLQLYASMLHERRIVIISSKLSTLTACIHGSAALLYPMY
WQHIYIPVLPPHLLDYCCAPMPYLIGIHSSLIERVKNKSLEDVVMLNVDTNTLESPFSDL
NNLPSDVVSALKNKLKKQSTATGDGVARAFLRAQAALFGSYRDALRYKPGEPITFCEESF
VKHRSSVMKQFLETAINLQLFKQFIDGRLAKLNAGRGFSDVFEEEITSGGFCGGNPRSYQ
QWVHTVKKGGALFNTAMTKATPAVRTAYKFAKNHAKLGLKEVKSKLKHKENEEDYGTCSS
SVQYTPVYKLHNEKGGNSEKRKLAQARLKRPLKSLDGALYDDEDDDDIERASKLSSEDGE
EASAYLYESDDSVETRVKTPYSGEMDLLGEILDTLSTHSSDQGKLAAAKSLDFFRSMDDI
DYKPTNKSNAPSENNLAFLCGGSGDQAEWNLGQDDSALHGKHLPPSPRKRVSSSGLTDSL
FILKEENSNKHLGADNVSDPTSGLDFQLTSPEVSQTDKGKTEKRETLSQISDDLLIPGLG
RHSSTFVPWEKEGKEAKETSEDIGLLHEVVSLCHMTSDFQQSLNISDKNTNGNQT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6P3S1	1.000	1.000	0.000	775	1.000	1.000	Q6P3S1.pdb.gz	DEN1B_HUMAN DENN domain-containing protein 1B OS=Homo sapiens OX=9606 GN=DENND1B PE=1 SV=2
2	AFDB:Q3U1T9	0.666	0.674	1.470E-103	766	0.836	0.846	Q3U1T9.pdb.gz	DEN1B_MOUSE DENN domain-containing protein 1B OS=Mus musculus OX=10090 GN=Dennd1b PE=1 SV=3
3	AFDB:Q8TEH3	0.560	0.432	2.583E-64	1009	0.474	0.364	Q8TEH3.pdb.gz	DEN1A_HUMAN DENN domain-containing protein 1A OS=Homo sapiens OX=9606 GN=DENND1A PE=1 SV=2
4	AFDB:Q8K382	0.582	0.448	1.703E-63	1016	0.471	0.359	Q8K382.pdb.gz	DEN1A_MOUSE DENN domain-containing protein 1A OS=Mus musculus OX=10090 GN=Dennd1a PE=1 SV=2
5	AFDB:Q8IV53	0.548	0.531	1.148E-53	801	0.370	0.358	Q8IV53.pdb.gz	DEN1C_HUMAN DENN domain-containing protein 1C OS=Homo sapiens OX=9606 GN=DENND1C PE=1 SV=1
6	AFDB:A0A0A0MS48	0.422	0.703	3.219E-45	459	0.343	0.580	A0A0A0MS48.pdb.gz	A0A0A0MS48_HUMAN DENN domain containing 1A OS=Homo sapiens OX=9606 GN=DENND1A PE=1 SV=2
7	PDB:6nzdH	0.149	0.270	6.586E-5	387	0.054	0.109	6nzdH.pdb.gz	Structural mechanism of a Rag GTPase activation checkpoint by the lysosomal folliculin complex.
8	PDB:7mgeC	0.144	0.247	1.737E-4	365	0.068	0.145	7mgeC.pdb.gz	Structural basis for the ARF GAP activity and specificity of the C9orf72 complex.
9	PDB:6ulgL	0.172	0.268	9.232E-4	458	0.065	0.109	6ulgL.pdb.gz	Cryo-EM Structure of the Human FLCN-FNIP2-Rag-Ragulator Complex.
10	PDB:7o2wA	0.171	0.269	3.021E-3	418	0.063	0.117	7o2wA.pdb.gz
11	PDB:6lt0C	0.122	0.226	4.649E-3	385	0.059	0.119	6lt0C.pdb.gz
12	PDB:6lt0B	0.152	0.268	4.469E-2	386	0.061	0.122	6lt0B.pdb.gz
13	PDB:7o2wB	0.139	0.224	6.175E-2	422	0.040	0.073	7o2wB.pdb.gz
14	PDB:7mgeB	0.153	0.237	1.179E-1	442	0.040	0.070	7mgeB.pdb.gz	Structural basis for the ARF GAP activity and specificity of the C9orf72 complex.
15	PDB:7b6dE	0.107	0.480	1.386E-1	139	0.021	0.115	7b6dE.pdb.gz
16	PDB:2j3wA	0.103	0.425	1.814E-1	142	0.025	0.134	2j3wA.pdb.gz
17	AFDB:Q1HKZ5	0.102	0.088	2.066E-1	959	0.125	0.101	Q1HKZ5.pdb.gz	M3K13_MOUSE Mitogen-activated protein kinase kinase kinase 13 OS=Mus musculus OX=10090 GN=Map3k13 PE=1 SV=1
18	AFDB:P48479	0.066	0.062	3.180E-1	858	0.132	0.119	P48479.pdb.gz	NIM1_NEUCR G2-specific protein kinase nim-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=nim-1 PE=2 SV=2
19	AFDB:A0A024RCS3	0.061	0.063	3.945E-1	740	0.135	0.142	A0A024RCS3.pdb.gz	A0A024RCS3_HUMAN Death domain-associated protein 6 OS=Homo sapiens OX=9606 PE=3 SV=1
20	AFDB:P49418	0.052	0.056	4.893E-1	695	0.089	0.099	P49418.pdb.gz	AMPH_HUMAN Amphiphysin OS=Homo sapiens OX=9606 GN=AMPH PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MS48	0.0	641	1070	0.396	0.287	A0A0A0MS48_HUMAN DENN domain containing 1A OS=Homo sapiens OX=9606 GN=DENND1A PE=1 SV=2
2	Q3U1T9	0.0	1318	766	0.839	0.849	DEN1B_MOUSE DENN domain-containing protein 1B OS=Mus musculus OX=10090 GN=Dennd1b PE=1 SV=3
3	Q6P3S1	0.0	1612	775	1.000	1.000	DEN1B_HUMAN DENN domain-containing protein 1B OS=Homo sapiens OX=9606 GN=DENND1B PE=1 SV=2
4	Q8K382	0.0	654	1016	0.463	0.353	DEN1A_MOUSE DENN domain-containing protein 1A OS=Mus musculus OX=10090 GN=Dennd1a PE=1 SV=2
5	Q8TEH3	0.0	649	1009	0.459	0.353	DEN1A_HUMAN DENN domain-containing protein 1A OS=Homo sapiens OX=9606 GN=DENND1A PE=1 SV=2
6	Q8IV53	2.32e-171	515	801	0.364	0.352	DEN1C_HUMAN DENN domain-containing protein 1C OS=Homo sapiens OX=9606 GN=DENND1C PE=1 SV=1
7	G5ECW9	2.65e-65	231	661	0.187	0.219	G5ECW9_CAEEL UDENN domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=rme-4 PE=1 SV=1
8	P78524	7.71e-35	145	1137	0.152	0.104	DEN2B_HUMAN DENN domain-containing protein 2B OS=Homo sapiens OX=9606 GN=DENND2B PE=1 SV=3
9	Q9H6A0	1.42e-33	137	471	0.142	0.234	DEN2D_HUMAN DENN domain-containing protein 2D OS=Homo sapiens OX=9606 GN=DENND2D PE=1 SV=2
10	Q9ULE3	9.04e-32	135	1009	0.148	0.114	DEN2A_HUMAN DENN domain-containing protein 2A OS=Homo sapiens OX=9606 GN=DENND2A PE=1 SV=4
11	Q68D51	2.70e-31	134	928	0.138	0.115	DEN2C_HUMAN DENN domain-containing protein 2C OS=Homo sapiens OX=9606 GN=DENND2C PE=1 SV=2
12	Q8RXA7	5.59e-18	91.7	1187	0.102	0.067	SCD1_ARATH DENN domain and WD repeat-containing protein SCD1 OS=Arabidopsis thaliana OX=3702 GN=SCD1 PE=1 SV=1
13	Q7KSP6	5.46e-17	88.6	1973	0.133	0.052	Q7KSP6_DROME SET domain binding factor, isoform B OS=Drosophila melanogaster OX=7227 GN=Sbf PE=1 SV=1
14	Q9VGH9	5.66e-17	88.6	1993	0.133	0.052	Q9VGH9_DROME SET domain binding factor, isoform A OS=Drosophila melanogaster OX=7227 GN=Sbf PE=1 SV=3
15	E9PXF8	1.03e-15	84.3	1872	0.129	0.053	MTMRD_MOUSE Myotubularin-related protein 13 OS=Mus musculus OX=10090 GN=Sbf2 PE=1 SV=1
16	Q5VZ89	9.02e-15	81.3	1909	0.121	0.049	DEN4C_HUMAN DENN domain-containing protein 4C OS=Homo sapiens OX=9606 GN=DENND4C PE=1 SV=3
17	Q6ZPE2	1.07e-14	81.3	1867	0.133	0.055	MTMR5_MOUSE Myotubularin-related protein 5 OS=Mus musculus OX=10090 GN=Sbf1 PE=1 SV=2
18	Q86WG5	1.14e-14	80.9	1849	0.119	0.050	MTMRD_HUMAN Myotubularin-related protein 13 OS=Homo sapiens OX=9606 GN=SBF2 PE=1 SV=1
19	A0A8I6AD51	4.57e-14	79.0	1875	0.081	0.034	A0A8I6AD51_RAT SET binding factor 1 OS=Rattus norvegicus OX=10116 GN=Sbf1 PE=1 SV=1
20	Q7Z401	4.72e-14	79.0	1863	0.132	0.055	MYCPP_HUMAN C-myc promoter-binding protein OS=Homo sapiens OX=9606 GN=DENND4A PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03455 dDENN	1.1e-05	36.8	dDENN domain
2	PF02141 DENN	2.4e-39	146.7	DENN (AEX-3) domain
3	PF03456 uDENN	5.6e-09	47.7	uDENN domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000479816

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000229340	0.999	Ras-related protein Rab-35
2	9606.ENSP00000350386	0.904	Rab proteins geranylgeranyltransferase component A 1
3	9606.ENSP00000355511	0.904	Rab proteins geranylgeranyltransferase component A 2
4	9606.ENSP00000394071	0.902	Rab GDP dissociation inhibitor alpha
5	9606.ENSP00000369538	0.901	Rab GDP dissociation inhibitor beta
6	9606.ENSP00000263826	0.900	RAC-gamma serine/threonine-protein kinase
7	9606.ENSP00000375892	0.900	RAC-beta serine/threonine-protein kinase
8	9606.ENSP00000451828	0.900	RAC-alpha serine/threonine-protein kinase
9	9606.ENSP00000377724	0.760	ORM1-like protein 3
10	9606.ENSP00000412763	0.692	MAM and LDL-receptor class A domain-containing protein 1
11	9606.ENSP00000479606	0.659	Clathrin heavy chain 1
12	9606.ENSP00000415049	0.637	Gasdermin-B
13	9606.ENSP00000345502	0.631	cAMP-specific 3',5'-cyclic phosphodiesterase 4D
14	9606.ENSP00000376345	0.630	Growth factor receptor-bound protein 2
15	9606.ENSP00000356355	0.622	Serine/threonine-protein kinase Nek7
16	9606.ENSP00000356357	0.603	LIM/homeobox protein Lhx9
17	9606.ENSP00000287008	0.601	Protocadherin-1
18	9606.ENSP00000362702	0.581	Serine/threonine-protein kinase Nek6
19	9606.ENSP00000356370	0.578	Protein crumbs homolog 1
20	9606.ENSP00000367151	0.576	Protocadherin-17

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005085	1.000	guanyl-nucleotide exchange factor activity
GO:0019899	0.687	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0007165	0.988	signal transduction
GO:0048583	0.987	regulation of response to stimulus
GO:0010604	0.986	positive regulation of macromolecule metabolic process
GO:0050776	0.980	regulation of immune response
GO:0048584	0.979	positive regulation of response to stimulus
GO:0010468	0.978	regulation of gene expression
GO:0001819	0.972	positive regulation of cytokine production
GO:0007166	0.968	cell surface receptor signaling pathway
GO:0002757	0.960	immune response-activating signaling pathway
GO:0002706	0.957	regulation of lymphocyte mediated immunity
GO:0002822	0.957	regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0002768	0.957	immune response-regulating cell surface receptor signaling pathway
GO:0002700	0.956	regulation of production of molecular mediator of immune response
GO:0050852	0.953	T cell receptor signaling pathway
GO:0002709	0.950	regulation of T cell mediated immunity
GO:0002720	0.950	positive regulation of cytokine production involved in immune response
GO:0002708	0.949	positive regulation of lymphocyte mediated immunity
GO:0002824	0.949	positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0002711	0.908	positive regulation of T cell mediated immunity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005654	0.996	nucleoplasm
GO:0016604	0.750	nuclear body
GO:0012505	0.725	endomembrane system
GO:0016607	0.711	nuclear speck
GO:0031982	0.685	vesicle
GO:0016020	0.655	membrane
GO:0031410	0.476	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]