StarFunc result for job id Q6P3W2

User Input

>input (149 residues)
MMAVEQMPKKDWYSILGADPSANISDLKQKYQKLILMYHPDKQSTDVPAGTVEECVQKFI
EIDQAWKILGNEETKREYDLQRCEDDLRNVGPVDAQVYLEEMSWNEGDHSFYLSCRCGGK
YSVSKDEAEEVSLISCDTCSLIIELLHYN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6P3W2	1.000	1.000	3.494E-30	149	1.000	1.000	Q6P3W2.pdb.gz	DJC24_HUMAN DnaJ homolog subfamily C member 24 OS=Homo sapiens OX=9606 GN=DNAJC24 PE=1 SV=2
2	PDB:2l6lA	0.400	0.391	7.011E-23	155	1.000	0.961	2l6lA.pdb.gz	Structure and mechanistic insights into novel iron-mediated moonlighting functions of human J-protein cochaperone, Dph4.
3	AFDB:Q9UUG3	0.424	0.450	3.082E-11	139	0.255	0.273	Q9UUG3.pdb.gz	DPH4_SCHPO Diphthamide biosynthesis protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dph4 PE=3 SV=1
4	AFDB:Q388Z0	0.462	0.419	1.908E-10	166	0.282	0.253	Q388Z0.pdb.gz	Q388Z0_TRYB2 Chaperone protein DNAJ, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.389.1150 PE=3 SV=1
5	AFDB:P47138	0.433	0.384	6.054E-9	172	0.268	0.233	P47138.pdb.gz	DPH4_YEAST Diphthamide biosynthesis protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=JJJ3 PE=1 SV=1
6	AFDB:Q6VUC1	0.366	0.641	8.345E-6	82	0.094	0.171	Q6VUC1.pdb.gz	DPH3_CRIGR Diphthamide biosynthesis protein 3 OS=Cricetulus griseus OX=10029 GN=DPH3 PE=3 SV=1
7	AFDB:Q9UT33	0.361	0.653	9.463E-6	79	0.081	0.152	Q9UT33.pdb.gz	DPH3_SCHPO Diphthamide biosynthesis protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dph3 PE=3 SV=1
8	AFDB:Q21102	0.367	0.658	1.008E-5	80	0.081	0.150	Q21102.pdb.gz	DPH3_CAEEL Diphthamide biosynthesis protein 3 OS=Caenorhabditis elegans OX=6239 GN=dph-3 PE=3 SV=1
9	PDB:2jr7A	0.354	0.605	2.354E-5	84	0.101	0.179	2jr7A.pdb.gz	Solution structure of human DESR1, a CSL zinc-binding protein
10	AFDB:P40358	0.513	0.127	2.587E-5	645	0.208	0.048	P40358.pdb.gz	JEM1_YEAST DnaJ-like chaperone JEM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=JEM1 PE=1 SV=3
11	AFDB:P36659	0.407	0.203	2.755E-5	306	0.255	0.124	P36659.pdb.gz	CBPA_ECOLI Curved DNA-binding protein OS=Escherichia coli (strain K12) OX=83333 GN=cbpA PE=1 SV=2
12	AFDB:Q72AW4	0.416	0.206	2.934E-5	316	0.262	0.123	Q72AW4.pdb.gz	Q72AW4_DESVH DnaJ protein, putative OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=DVU_1876 PE=1 SV=1
13	PDB:4d4oA	0.355	0.132	3.655E-5	414	0.087	0.031	4d4oA.pdb.gz	Structure of the Kti11/Kti13 Heterodimer and its Double Role in Modifications of tRNA and Eukaryotic Elongation Factor 2.
14	PDB:6byrA	0.429	0.165	6.854E-5	405	0.208	0.077	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
15	PDB:5y88T	0.317	0.418	8.669E-3	107	0.148	0.206	5y88T.pdb.gz	Structure of an Intron Lariat Spliceosome from Saccharomyces cerevisiae
16	PDB:2y4uA	0.377	0.140	2.687E-2	424	0.134	0.047	2y4uA.pdb.gz
17	PDB:7x3kA	0.402	0.240	3.047E-2	262	0.215	0.122	7x3kA.pdb.gz
18	PDB:1fpoA	0.404	0.356	5.039E-2	171	0.128	0.111	1fpoA.pdb.gz
19	PDB:4mk0A	0.193	0.078	4.548E-1	631	0.094	0.022	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
20	PDB:2yf3C	0.238	0.234	7.519E-1	153	0.114	0.111	2yf3C.pdb.gz	Structural and Functional Insights Into Dr2231 Protein, the Mazg-Like Nucleoside Triphosphate Pyrophosphohydrolase from Deinococcus Radiodurans.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6P3W2	4.62e-110	310	149	1.000	1.000	DJC24_HUMAN DnaJ homolog subfamily C member 24 OS=Homo sapiens OX=9606 GN=DNAJC24 PE=1 SV=2
2	Q9LYW9	5.97e-13	67.0	482	0.235	0.073	DNJ36_ARATH DnaJ protein P58IPK homolog OS=Arabidopsis thaliana OX=3702 GN=P58IPK PE=1 SV=1
3	Q388Z0	2.37e-11	60.5	166	0.289	0.259	Q388Z0_TRYB2 Chaperone protein DNAJ, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.389.1150 PE=3 SV=1
4	Q54IP0	4.42e-11	61.6	539	0.208	0.058	DNJC7_DICDI DnaJ homolog subfamily C member 7 homolog OS=Dictyostelium discoideum OX=44689 GN=dnajc7 PE=1 SV=1
5	Q7ZW83	5.58e-11	60.5	237	0.195	0.122	Q7ZW83_DANRE DnaJ (Hsp40) homolog, subfamily B, member 6 OS=Danio rerio OX=7955 GN=dnajb6 PE=2 SV=1
6	Q5JNB5	1.42e-10	60.1	471	0.235	0.074	DJC15_ORYSJ DnaJ protein P58IPK homolog B OS=Oryza sativa subsp. japonica OX=39947 GN=P58B PE=1 SV=1
7	Q27237	2.39e-10	59.7	520	0.188	0.054	TID_DROME Protein tumorous imaginal discs, mitochondrial OS=Drosophila melanogaster OX=7227 GN=CG5504 PE=1 SV=2
8	A0A0P0VG31	7.17e-10	58.2	476	0.228	0.071	DJC16_ORYSJ DnaJ protein P58IPK homolog A OS=Oryza sativa subsp. japonica OX=39947 GN=P58A PE=1 SV=1
9	Q10MW6	8.87e-10	57.8	582	0.188	0.048	DJC27_ORYSJ DnaJ protein ERDJ3A OS=Oryza sativa subsp. japonica OX=39947 GN=ERDJ3A PE=1 SV=2
10	Q9UUG3	1.18e-09	55.5	139	0.268	0.288	DPH4_SCHPO Diphthamide biosynthesis protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dph4 PE=3 SV=1
11	Q9FHS7	1.53e-09	57.4	431	0.188	0.065	Q9FHS7_ARATH AT5g37380/MNJ8_170 OS=Arabidopsis thaliana OX=3702 GN=MNJ8.20 PE=1 SV=1
12	P40358	1.96e-09	57.0	645	0.201	0.047	JEM1_YEAST DnaJ-like chaperone JEM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=JEM1 PE=1 SV=3
13	Q387E9	2.15e-09	56.6	371	0.242	0.097	Q387E9_TRYB2 Chaperone protein DNAJ, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0110 PE=4 SV=1
14	O76224	3.73e-09	55.8	336	0.188	0.083	O76224_9TRYP Chaperone OS=Trypanosoma brucei OX=5691 GN=DNAJ PE=4 SV=1
15	Q38AB7	3.73e-09	55.8	336	0.188	0.083	Q38AB7_TRYB2 Chaperone protein DNAJ, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.2000 PE=4 SV=1
16	Q9HGM9	7.63e-09	55.1	476	0.174	0.055	DNJC7_SCHPO DnaJ homolog subfamily C member 7 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC543.02c PE=4 SV=1
17	Q8L7R1	1.00e-08	53.1	156	0.148	0.141	Q8L7R1_ARATH At1g56300 OS=Arabidopsis thaliana OX=3702 GN=DJC53 PE=1 SV=1
18	Q9UBS4	1.36e-08	54.3	358	0.168	0.070	DJB11_HUMAN DnaJ homolog subfamily B member 11 OS=Homo sapiens OX=9606 GN=DNAJB11 PE=1 SV=1
19	Q6TUG0	1.39e-08	54.3	358	0.168	0.070	DJB11_RAT DnaJ homolog subfamily B member 11 OS=Rattus norvegicus OX=10116 GN=Dnajb11 PE=2 SV=1
20	Q99KV1	1.42e-08	54.3	358	0.168	0.070	DJB11_MOUSE DnaJ homolog subfamily B member 11 OS=Mus musculus OX=10090 GN=Dnajb11 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00226 DnaJ	4.5e-13	60.4	DnaJ domain
2	PF05207 zf-CSL	8.9e-11	52.7	CSL zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000417548

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000307940	0.966	Elongation factor 2
2	9606.ENSP00000263083	0.887	2-(3-amino-3-carboxypropyl)histidine synthase subunit 1
3	9606.ENSP00000255108	0.882	2-(3-amino-3-carboxypropyl)histidine synthase subunit 2
4	9606.ENSP00000277540	0.869	Diphthine methyltransferase
5	9606.ENSP00000419599	0.859	DPH3 homolog
6	9606.ENSP00000297185	0.851	Stress-70 protein, mitochondrial
7	9606.ENSP00000359127	0.847	Diphthine methyl ester synthase
8	9606.ENSP00000278200	0.843	Mitochondrial inner membrane protease subunit 1
9	9606.ENSP00000256538	0.795	Diphthine--ammonia ligase
10	9606.ENSP00000350833	0.775	Metallophosphoesterase MPPED2
11	9606.ENSP00000379267	0.768	Elongator complex protein 4
12	9606.ENSP00000385936	0.767	Doublecortin domain-containing protein 5
13	9606.ENSP00000371451	0.756	DnaJ homolog subfamily C member 21
14	9606.ENSP00000270538	0.746	Mitochondrial import inner membrane translocase subunit TIM44
15	9606.ENSP00000420200	0.740	[Protein ADP-ribosylarginine] hydrolase
16	9606.ENSP00000241051	0.736	DEP domain containing 7
17	9606.ENSP00000298705	0.715	Protein phosphatase 1 regulatory subunit 36
18	9606.ENSP00000331327	0.697	Wilms tumor protein
19	9606.ENSP00000369251	0.688	Putative nucleotidyltransferase MAB21L1
20	9606.ENSP00000294053	0.681	Caseinolytic peptidase B protein homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0001671	1.000	ATPase activator activity
GO:0008270	1.000	zinc ion binding
GO:0008198	0.999	ferrous iron binding
GO:0005515	0.997	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0009987	0.992	cellular process
GO:0006457	0.984	protein folding
GO:0061077	0.922	chaperone-mediated protein folding
GO:0065009	0.831	regulation of molecular function
GO:0032781	0.776	positive regulation of ATP-dependent activity
GO:0050789	0.758	regulation of biological process
GO:0050794	0.699	regulation of cellular process
GO:0019222	0.382	regulation of metabolic process
GO:0080090	0.357	regulation of primary metabolic process
GO:0060255	0.357	regulation of macromolecule metabolic process
GO:0051171	0.336	regulation of nitrogen compound metabolic process
GO:0008152	0.335	metabolic process
GO:0031323	0.320	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005634	0.978	nucleus
GO:0070013	0.958	intracellular organelle lumen
GO:0005829	0.890	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]