StarFunc result for job id Q6P3X8

User Input

>input (592 residues)
MASTSRDVIAGRGIHSKVKSAKLLEVLNAMEEEESNNNREEIFIAPPDNAAGEFTDEDSG
DEDSQRGAHLPGSVLHASVLCEDSGTGEDNDDLELQPAKKRQKAVVKPQRIWTKRDIRPD
FGSWTASDPHIEDLKSQELSPVGLFELFFDEGTINFIVNETNRYAWQKNVNLSLTAQELK
CVLGILILSGYISYPRRRMFWETSPDSHHHLVADAIRRDRFELIFSYLHFADNNELDASD
RFAKVRPLIIRMNCNFQKHAPLEEFYSFGESMCEYFGHRGSKQLHRGKPVRLGYKIWCGT
TSRGYLVWFEPSQGTLFTKPDRSLDLGGSMVIKFVDALQERGFLPYHIFFDKVFTSVKLM
SILRKKGVKATGTVREYRTERCPLKDPKELKKMKRGSFDYKVDESEEIIVCRWHDSSVVN
ICSNAVGIEPVRLTSRHSGAAKTRTQVHQPSLVKLYQEKVGGVGRMDQNIAKYKVKIRGM
KWYSSFIGYVIDAALNNAWQLHRICCQDAQVDLLAFRRYIACVYLESNADTTSQGRRSRR
LETESRFDMIGHWIIHQDKRTRCALCHSQTNTRCEKCQKGVHAKCFREYHIR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0DP91	0.806	0.459	1.666E-56	1061	0.431	0.240	P0DP91.pdb.gz	ERPG3_HUMAN Chimeric ERCC6-PGBD3 protein OS=Homo sapiens OX=9606 GN=ERCC6 PE=1 SV=1
2	AFDB:Q96JS3	0.706	0.519	1.808E-54	809	0.443	0.324	Q96JS3.pdb.gz	PGBD1_HUMAN PiggyBac transposable element-derived protein 1 OS=Homo sapiens OX=9606 GN=PGBD1 PE=1 SV=1
3	AFDB:Q8N414	0.545	0.609	2.741E-20	524	0.167	0.189	Q8N414.pdb.gz	PGBD5_HUMAN PiggyBac transposable element-derived protein 5 OS=Homo sapiens OX=9606 GN=PGBD5 PE=1 SV=4
4	AFDB:Q7Z3K3	0.181	0.092	5.948E-3	1410	0.115	0.048	Q7Z3K3.pdb.gz	POGZ_HUMAN Pogo transposable element with ZNF domain OS=Homo sapiens OX=9606 GN=POGZ PE=1 SV=2
5	PDB:5guhA	0.135	0.113	1.160E-2	759	0.071	0.055	5guhA.pdb.gz	Crystal Structure of Silkworm PIWI-Clade Argonaute Siwi Bound to piRNA
6	PDB:6oonA	0.138	0.113	1.160E-2	785	0.052	0.039	6oonA.pdb.gz	Multidomain Convergence of Argonaute during RISC Assembly Correlates with the Formation of Internal Water Clusters.
7	AFDB:Q9VUQ5	0.165	0.098	2.789E-2	1214	0.071	0.035	Q9VUQ5.pdb.gz	AGO2_DROME Protein argonaute-2 OS=Drosophila melanogaster OX=7227 GN=AGO2 PE=1 SV=3
8	PDB:4w5tA	0.133	0.107	3.792E-2	807	0.047	0.035	4w5tA.pdb.gz	Gene regulation. Structural basis for microRNA targeting.
9	PDB:6ks6h	0.081	0.086	2.300E-1	527	0.091	0.102	6ks6h.pdb.gz	An ensemble of cryo-EM structures of TRiC reveal its conformational landscape and subunit specificity.
10	AFDB:O88842	0.079	0.069	3.305E-1	733	0.127	0.102	O88842.pdb.gz	FGD3_MOUSE FYVE, RhoGEF and PH domain-containing protein 3 OS=Mus musculus OX=10090 GN=Fgd3 PE=1 SV=1
11	PDB:6krdd	0.077	0.088	4.494E-1	480	0.076	0.094	6krdd.pdb.gz
12	PDB:7pmyA	0.071	0.064	4.731E-1	657	0.027	0.024	7pmyA.pdb.gz	Structural snapshots of human PepT1 and PepT2 reveal mechanistic insights into substrate and drug transport across epithelial membranes.
13	PDB:3rg2C	0.088	0.086	4.981E-1	613	0.039	0.038	3rg2C.pdb.gz	Structural and Functional Investigation of the Intermolecular Interaction between NRPS Adenylation and Carrier Protein Domains.
14	AFDB:O04379	0.126	0.085	5.254E-1	1048	0.051	0.029	O04379.pdb.gz	AGO1_ARATH Protein argonaute 1 OS=Arabidopsis thaliana OX=3702 GN=AGO1 PE=1 SV=1
15	PDB:6ks6d	0.081	0.089	5.522E-1	524	0.047	0.053	6ks6d.pdb.gz	An ensemble of cryo-EM structures of TRiC reveal its conformational landscape and subunit specificity.
16	PDB:4s2rP	0.095	0.092	5.814E-1	615	0.051	0.049	4s2rP.pdb.gz	Crystal structure of X-prolyl aminopeptidase from Caenorhabditis elegans: A cytosolic enzyme with a di-nuclear active site.
17	PDB:7kpvD	0.122	0.088	6.445E-1	876	0.041	0.027	7kpvD.pdb.gz
18	AFDB:P38931	0.136	0.069	7.535E-1	1420	0.047	0.020	P38931.pdb.gz	SSN2_YEAST Mediator of RNA polymerase II transcription subunit 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SSN2 PE=1 SV=2
19	AFDB:Q86RS9	0.070	0.060	1.081	741	0.046	0.036	Q86RS9.pdb.gz	Q86RS9_CAEEL Rap1GAP (Fragment) OS=Caenorhabditis elegans OX=6239 PE=1 SV=1
20	AFDB:Q0E8C8	0.071	0.089	1.550	450	0.041	0.053	Q0E8C8.pdb.gz	SP77B_DROME Serine protease inhibitor 77Ba OS=Drosophila melanogaster OX=7227 GN=Spn77Ba PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96JS3	0.0	536	809	0.449	0.329	PGBD1_HUMAN PiggyBac transposable element-derived protein 1 OS=Homo sapiens OX=9606 GN=PGBD1 PE=1 SV=1
2	Q8N328	9.75e-163	479	593	0.434	0.433	PGBD3_HUMAN PiggyBac transposable element-derived protein 3 OS=Homo sapiens OX=9606 GN=PGBD3 PE=1 SV=3
3	P0DP91	1.55e-157	480	1061	0.434	0.242	ERPG3_HUMAN Chimeric ERCC6-PGBD3 protein OS=Homo sapiens OX=9606 GN=ERCC6 PE=1 SV=1
4	Q8N414	3.30e-04	45.8	524	0.145	0.164	PGBD5_HUMAN PiggyBac transposable element-derived protein 5 OS=Homo sapiens OX=9606 GN=PGBD5 PE=1 SV=4
5	D3YZI9	0.004	42.4	523	0.152	0.172	PGBD5_MOUSE PiggyBac transposable element-derived protein 5 OS=Mus musculus OX=10090 GN=Pgbd5 PE=1 SV=1
6	O43255	4.5	32.3	324	0.034	0.062	SIAH2_HUMAN E3 ubiquitin-protein ligase SIAH2 OS=Homo sapiens OX=9606 GN=SIAH2 PE=1 SV=1
7	Q06986	7.2	31.6	325	0.032	0.058	SIAH2_MOUSE E3 ubiquitin-protein ligase SIAH2 OS=Mus musculus OX=10090 GN=Siah2 PE=1 SV=2
8	Q8R4T2	7.2	31.6	325	0.032	0.058	SIAH2_RAT E3 ubiquitin-protein ligase SIAH2 OS=Rattus norvegicus OX=10116 GN=Siah2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00130 C1_1	2.4e+02	13.0	Phorbol esters/diacylglycerol binding domain (C1 domain)
2	PF18624 CdiI_4	2.7e+02	13.4	CDI immunity protein
3	PF13843 DDE_Tnp_1_7	1.9e-97	338.4	Transposase IS4

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000331643

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000386184	0.790	Protein ZBED8
2	9606.ENSP00000431404	0.731	PiggyBac transposable element-derived protein 5
3	9606.ENSP00000305533	0.701	DNA transposase THAP9
4	9606.ENSP00000356849	0.633	Pogo transposable element derived with KRAB domain
5	9606.ENSP00000362170	0.575	Nuclear apoptosis-inducing factor 1
6	9606.ENSP00000260045	0.558	52 kDa repressor of the inhibitor of the protein kinase
7	9606.ENSP00000370621	0.551	Zinc finger BED domain-containing protein 1
8	9606.ENSP00000252015	0.541	Short transient receptor potential channel 4-associated protein
9	9606.ENSP00000480556	0.508	Zinc finger protein 718
10	9606.ENSP00000421915	0.507	Zinc finger protein 672
11	9606.ENSP00000223210	0.502	Zinc finger protein 862

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043565	0.998	sequence-specific DNA binding
GO:0005515	0.970	protein binding
GO:0003824	0.541	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.965	regulation of biological process
GO:0050794	0.946	regulation of cellular process
GO:0009987	0.936	cellular process
GO:0048518	0.804	positive regulation of biological process
GO:0008152	0.793	metabolic process
GO:0031323	0.773	regulation of cellular metabolic process
GO:0071704	0.712	organic substance metabolic process
GO:0051173	0.678	positive regulation of nitrogen compound metabolic process
GO:0044238	0.664	primary metabolic process
GO:0019219	0.657	regulation of nucleobase-containing compound metabolic process
GO:0048522	0.642	positive regulation of cellular process
GO:0010604	0.638	positive regulation of macromolecule metabolic process
GO:0006807	0.628	nitrogen compound metabolic process
GO:0044237	0.584	cellular metabolic process
GO:0031325	0.566	positive regulation of cellular metabolic process
GO:0043170	0.508	macromolecule metabolic process
GO:0080134	0.478	regulation of response to stress
GO:0045935	0.456	positive regulation of nucleobase-containing compound metabolic process
GO:0080135	0.432	regulation of cellular response to stress
GO:0051052	0.432	regulation of DNA metabolic process
GO:0048584	0.412	positive regulation of response to stimulus
GO:0044260	0.405	cellular macromolecule metabolic process
GO:0050896	0.397	response to stimulus
GO:0051174	0.358	regulation of phosphorus metabolic process
GO:0031399	0.356	regulation of protein modification process
GO:0051247	0.350	positive regulation of protein metabolic process
GO:0042325	0.345	regulation of phosphorylation
GO:0002831	0.339	regulation of response to biotic stimulus
GO:0010628	0.331	positive regulation of gene expression
GO:0031401	0.329	positive regulation of protein modification process
GO:0001932	0.329	regulation of protein phosphorylation
GO:0042327	0.329	positive regulation of phosphorylation
GO:0001934	0.324	positive regulation of protein phosphorylation
GO:0032101	0.323	regulation of response to external stimulus
GO:0051054	0.321	positive regulation of DNA metabolic process
GO:0031347	0.307	regulation of defense response

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.999	nuclear lumen
GO:0005654	0.946	nucleoplasm
GO:0016604	0.686	nuclear body
GO:0043232	0.419	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]