StarFunc result for job id Q6P461

User Input

>input (480 residues)
MLGRFQPFSLVRSFRLGFEACCYPNQKCATQTIRPPDSRCLVQAVSQNFNFAKDVLDQWS
QLEKDGLRGPYPALWKVSAKGEEDKWSFERMTQLSKKAASILSDTCALSHGDRLMIILPP
TPEAYWICLACVRLGITFVPGSPQLTAKKIRYQLRMSKAQCIVANEAMAPVVNSAVSDCP
TLKTKLLVSDKSYDGWLDFKKLIQVAPPKQTYMRTKSQDPMAIFFTKGTTGAPKMVEYSQ
YGLGMGFSQASRRWMDLQPTDVLWSLGDAFGGSLSLSAVLGTWFQGACVFLCHMPTFCPE
TVLNVLSRFPITTLSANPEMYQELLQHKCFTSYRFKSLKQCVAAGGPISPGVIEDWKRIT
KLDIYEGYGQTETGLLCATSKTIKLKPSSLGKPLPPYIVQIVDENSNLLPPGEEGNIAIR
IKLNQPASLYCPHMVSWEEYASARGHMLYLTGDRGIMDEDGYFWWSGRVDDVANALGQRL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7TN78	0.847	0.703	2.384E-59	580	0.442	0.366	Q7TN78.pdb.gz	ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acsm4 PE=1 SV=1
2	AFDB:Q53FZ2	0.855	0.703	1.156E-58	586	0.435	0.357	Q53FZ2.pdb.gz	ACSM3_HUMAN Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Homo sapiens OX=9606 GN=ACSM3 PE=1 SV=2
3	AFDB:Q9BEA2	0.837	0.699	3.309E-58	577	0.408	0.340	Q9BEA2.pdb.gz	ACSM1_BOVIN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Bos taurus OX=9913 GN=ACSM1 PE=1 SV=2
4	AFDB:Q91VA0	0.847	0.713	9.051E-56	573	0.392	0.328	Q91VA0.pdb.gz	ACSM1_MOUSE Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Mus musculus OX=10090 GN=Acsm1 PE=1 SV=1
5	AFDB:Q3UNX5	0.859	0.714	9.596E-56	580	0.415	0.343	Q3UNX5.pdb.gz	ACSM3_MOUSE Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Mus musculus OX=10090 GN=Acsm3 PE=1 SV=2
6	AFDB:Q08AH1	0.846	0.707	9.942E-55	577	0.398	0.331	Q08AH1.pdb.gz	ACSM1_HUMAN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Homo sapiens OX=9606 GN=ACSM1 PE=1 SV=1
7	AFDB:Q08AH3	0.843	0.704	2.847E-54	577	0.388	0.322	Q08AH3.pdb.gz	ACS2A_HUMAN Acyl-coenzyme A synthetase ACSM2A, mitochondrial OS=Homo sapiens OX=9606 GN=ACSM2A PE=1 SV=2
8	PDB:3b7wA	0.840	0.753	2.285E-53	537	0.390	0.348	3b7wA.pdb.gz	Structural snapshots for the conformation-dependent catalysis by human medium-chain acyl-coenzyme A synthetase ACSM2A.
9	AFDB:Q8K0L3	0.848	0.710	6.307E-53	575	0.379	0.317	Q8K0L3.pdb.gz	ACSM2_MOUSE Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Mus musculus OX=10090 GN=Acsm2 PE=1 SV=1
10	AFDB:Q729U8	0.820	0.718	3.449E-42	551	0.298	0.260	Q729U8.pdb.gz	Q729U8_DESVH AMP-binding protein OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=DVU_2250 PE=1 SV=1
11	AFDB:A4YDT1	0.796	0.681	9.010E-38	564	0.237	0.202	A4YDT1.pdb.gz	HBCL1_METS5 4-hydroxybutyrate--CoA ligase 1 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2) OX=399549 GN=Msed_0406 PE=1 SV=1
12	PDB:1ultA	0.767	0.694	8.836E-33	533	0.181	0.163	1ultA.pdb.gz
13	PDB:1ry2A	0.795	0.628	3.512E-31	615	0.208	0.163	1ry2A.pdb.gz	Crystal structure of yeast acetyl-coenzyme A synthetase in complex with AMP
14	PDB:2p20A	0.796	0.604	4.987E-31	641	0.212	0.159	2p20A.pdb.gz	Biochemical and Crystallographic Analysis of Substrate Binding and Conformational Changes in Acetyl-CoA Synthetase.
15	PDB:6q2mA	0.761	0.675	5.050E-29	544	0.158	0.140	6q2mA.pdb.gz	Mutagenesis and Structural Studies Reveal the Basis for the Activity and Stability Properties That Distinguish thePhotinusLuciferasesscintillansandpyralis.
16	PDB:3r44A	0.727	0.696	9.060E-29	502	0.171	0.163	3r44A.pdb.gz	The Mycobacterium tuberculosis Very-Long-Chain Fatty Acyl-CoA Synthetase: Structural Basis for Housing Lipid Substrates Longer than the Enzyme.
17	PDB:5ie2A	0.701	0.667	9.605E-29	506	0.181	0.172	5ie2A.pdb.gz	Crystal Structures of Arabidopsis thaliana Oxalyl-CoA Synthetase Essential for Oxalate Degradation
18	PDB:5bsmA	0.738	0.671	2.177E-28	530	0.194	0.175	5bsmA.pdb.gz	Structural Basis for Specificity and Flexibility in a Plant 4-Coumarate:CoA Ligase.
19	PDB:7kydA	0.724	0.654	3.475E-28	534	0.188	0.169	7kydA.pdb.gz	FruitFire: a luciferase based on a fruit fly metabolic enzyme.
20	PDB:3tsyA	0.723	0.431	4.391E-28	828	0.196	0.114	3tsyA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q80W40	1.09e-152	449	580	0.446	0.369	ACSM4_MOUSE Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Mus musculus OX=10090 GN=Acsm4 PE=2 SV=1
2	Q7TN78	1.94e-150	443	580	0.438	0.362	ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acsm4 PE=1 SV=1
3	Q53FZ2	6.17e-148	437	586	0.429	0.352	ACSM3_HUMAN Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Homo sapiens OX=9606 GN=ACSM3 PE=1 SV=2
4	Q3UNX5	4.08e-141	419	580	0.412	0.341	ACSM3_MOUSE Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Mus musculus OX=10090 GN=Acsm3 PE=1 SV=2
5	Q9BEA2	9.09e-137	408	577	0.408	0.340	ACSM1_BOVIN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Bos taurus OX=9913 GN=ACSM1 PE=1 SV=2
6	Q68CK6	2.46e-127	384	577	0.404	0.336	ACS2B_HUMAN Acyl-coenzyme A synthetase ACSM2B, mitochondrial OS=Homo sapiens OX=9606 GN=ACSM2B PE=1 SV=2
7	Q91VA0	7.89e-127	382	573	0.385	0.323	ACSM1_MOUSE Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Mus musculus OX=10090 GN=Acsm1 PE=1 SV=1
8	Q08AH1	2.04e-126	381	577	0.406	0.338	ACSM1_HUMAN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Homo sapiens OX=9606 GN=ACSM1 PE=1 SV=1
9	Q08AH3	7.55e-126	380	577	0.400	0.333	ACS2A_HUMAN Acyl-coenzyme A synthetase ACSM2A, mitochondrial OS=Homo sapiens OX=9606 GN=ACSM2A PE=1 SV=2
10	Q8K0L3	2.21e-121	368	575	0.383	0.320	ACSM2_MOUSE Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Mus musculus OX=10090 GN=Acsm2 PE=1 SV=1
11	Q729U8	7.39e-72	239	551	0.308	0.269	Q729U8_DESVH AMP-binding protein OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=DVU_2250 PE=1 SV=1
12	A4YDT1	5.97e-44	164	564	0.267	0.227	HBCL1_METS5 4-hydroxybutyrate--CoA ligase 1 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2) OX=399549 GN=Msed_0406 PE=1 SV=1
13	Q8ZKF6	2.51e-27	117	652	0.248	0.183	ACSA_SALTY Acetyl-coenzyme A synthetase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=acs PE=1 SV=1
14	P27550	6.37e-27	116	652	0.242	0.178	ACSA_ECOLI Acetyl-coenzyme A synthetase OS=Escherichia coli (strain K12) OX=83333 GN=acs PE=1 SV=2
15	P9WQD1	1.12e-24	109	651	0.229	0.169	ACSA_MYCTU Acetyl-coenzyme A synthetase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=acsA PE=1 SV=1
16	Q726Y7	1.37e-23	106	661	0.237	0.172	Q726Y7_DESVH Acetyl-coenzyme A synthetase OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=acsA PE=1 SV=1
17	P78773	6.52e-23	104	662	0.244	0.177	ACSA_SCHPO Probable acetyl-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC191.02c PE=1 SV=2
18	Q99NB1	6.05e-22	101	682	0.227	0.160	ACS2L_MOUSE Acetyl-coenzyme A synthetase 2-like, mitochondrial OS=Mus musculus OX=10090 GN=Acss1 PE=1 SV=1
19	D3ZZN3	4.01e-21	99.0	682	0.225	0.158	D3ZZN3_RAT Acetyl-coenzyme A synthetase OS=Rattus norvegicus OX=10116 GN=Acss1 PE=3 SV=1
20	Q5E268	1.84e-20	97.1	649	0.231	0.171	Q5E268_ALIF1 Acetyl-coenzyme A synthetase OS=Aliivibrio fischeri (strain ATCC 700601 / ES114) OX=312309 GN=acs PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00501 AMP-binding	1e-57	207.3	AMP-binding enzyme
2	PF20327 DUF6622	5.4e+02	11.7	Family of unknown function (DUF6622)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000340296

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000242592	0.907	Short-chain specific acyl-CoA dehydrogenase, mitochondrial
2	9606.ENSP00000278840	0.902	Fatty acid desaturase 2
3	9606.ENSP00000342056	0.551	Citrate synthase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016878	1.000	acid-thiol ligase activity
GO:0016405	1.000	CoA-ligase activity
GO:0005488	0.847	binding
GO:0005515	0.800	protein binding
GO:0016740	0.655	transferase activity
GO:0140657	0.494	ATP-dependent activity
GO:0015645	0.470	fatty acid ligase activity
GO:0016746	0.326	acyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.996	cellular metabolic process
GO:0071704	0.989	organic substance metabolic process
GO:0044238	0.988	primary metabolic process
GO:0006629	0.848	lipid metabolic process
GO:0044281	0.846	small molecule metabolic process
GO:0044255	0.692	cellular lipid metabolic process
GO:0009058	0.441	biosynthetic process
GO:0019752	0.378	carboxylic acid metabolic process
GO:0006631	0.374	fatty acid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.966	intracellular organelle lumen
GO:0005759	0.907	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:6.2.1.-	1.000	Acid--thiol ligases.
EC:2.-.-.-	0.655	Transferases.
EC:2.3.-.-	0.326	Acyltransferases.

[back to server]