StarFunc result for job id Q6P4A8

User Input

>input (553 residues)
MTRGGPGGRPGLPQPPPLLLLLLLLPLLLVTAEPPKPAGVYYATAYWMPAEKTVQVKNVM
DKNGDAYGFYNNSVKTTGWGILEIRAGYGSQTLSNEIIMFVAGFLEGYLTAPHMNDHYTN
LYPQLITKPSIMDKVQDFMEKQDKWTRKNIKEYKTDSFWRHTGYVMAQIDGLYVGAKKRA
ILEGTKPMTLFQIQFLNSVGDLLDLIPSLSPTKNGSLKVFKRWDMGHCSALIKVLPGFEN
ILFAHSSWYTYAAMLRIYKHWDFNVIDKDTSSSRLSFSSYPGFLESLDDFYILSSGLILL
QTTNSVFNKTLLKQVIPETLLSWQRVRVANMMADSGKRWADIFSKYNSGTYNNQYMVLDL
KKVKLNHSLDKGTLYIVEQIPTYVEYSEQTDVLRKGYWPSYNVPFHEKIYNWSGYPLLVQ
KLGLDYSYDLAPRAKIFRRDQGKVTDTASMKYIMRYNNYKKDPYSRGDPCNTICCREDLN
SPNPSPGGCYDTKVADIYLASQYTSYAISGPTVQGGLPVFRWDRFNKTLHQGMPEVYNFD
FITMKPILKLDIK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6P4A8	1.000	1.000	0.000	553	1.000	1.000	Q6P4A8.pdb.gz	PLBL1_HUMAN Phospholipase B-like 1 OS=Homo sapiens OX=9606 GN=PLBD1 PE=1 SV=2
2	AFDB:Q550U9	0.871	0.840	3.445E-49	574	0.318	0.307	Q550U9.pdb.gz	PLBLA_DICDI Phospholipase B-like protein A OS=Dictyostelium discoideum OX=44689 GN=plbA PE=1 SV=1
3	AFDB:Q3TCN2	0.836	0.779	1.682E-45	594	0.322	0.300	Q3TCN2.pdb.gz	PLBL2_MOUSE Putative phospholipase B-like 2 OS=Mus musculus OX=10090 GN=Plbd2 PE=1 SV=2
4	AFDB:Q8NHP8	0.841	0.790	2.401E-45	589	0.313	0.294	Q8NHP8.pdb.gz	PLBL2_HUMAN Putative phospholipase B-like 2 OS=Homo sapiens OX=9606 GN=PLBD2 PE=1 SV=2
5	PDB:3fgwA	0.827	0.863	1.726E-44	529	0.318	0.333	3fgwA.pdb.gz
6	AFDB:Q9VRK8	0.767	0.651	6.841E-29	658	0.228	0.191	Q9VRK8.pdb.gz	PLBL_DROME Putative phospholipase B-like lamina ancestor OS=Drosophila melanogaster OX=7227 GN=lama PE=2 SV=3
7	PDB:2x1cB	0.495	0.736	6.780E-11	356	0.101	0.157	2x1cB.pdb.gz
8	PDB:6dxwA	0.340	0.536	2.203E-7	328	0.060	0.101	6dxwA.pdb.gz
9	PDB:2hezA	0.253	0.406	1.514E-2	316	0.058	0.101	2hezA.pdb.gz
10	PDB:6swy4	0.080	0.164	6.962E-2	217	0.036	0.092	6swy4.pdb.gz
11	PDB:4mt6A	0.071	0.089	1.046E-1	389	0.060	0.085	4mt6A.pdb.gz
12	PDB:1q5rH	0.121	0.216	1.100E-1	251	0.054	0.120	1q5rH.pdb.gz
13	PDB:3mkaM	0.123	0.259	1.830E-1	224	0.033	0.080	3mkaM.pdb.gz
14	PDB:5ahjI	0.150	0.316	1.925E-1	204	0.047	0.127	5ahjI.pdb.gz	Macyranones: Structure, Biosynthesis, and Binding Mode of an Unprecedented Epoxyketone that Targets the 20S Proteasome.
15	PDB:1z7qF	0.133	0.237	2.242E-1	234	0.036	0.085	1z7qF.pdb.gz
16	AFDB:Q8GXY0	0.093	0.106	9.416E-1	467	0.047	0.056	Q8GXY0.pdb.gz	Q8GXY0_ARATH At2g37930 OS=Arabidopsis thaliana OX=3702 GN=At2g37930 PE=2 SV=1
17	AFDB:Q9FIS4	0.081	0.147	1.154	241	0.040	0.091	Q9FIS4.pdb.gz	Q9FIS4_ARATH ATP-dependent Clp protease ATP-binding subunit OS=Arabidopsis thaliana OX=3702 GN=MTG10.17 PE=1 SV=1
18	AFDB:Q382P4	0.063	0.035	1.488	1299	0.060	0.025	Q382P4.pdb.gz	Q382P4_TRYB2 IF rod domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.52.0008 PE=4 SV=1
19	AFDB:G1UB63	0.066	0.042	1.919	1018	0.029	0.016	G1UB63.pdb.gz	CSA1_CANAL Cell wall protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CSA1 PE=1 SV=1
20	AFDB:O80565	0.096	0.139	1.919	343	0.033	0.052	O80565.pdb.gz	OEP37_ARATH Outer envelope pore protein 37, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=OEP37 PE=2 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6P4A8	0.0	1145	553	1.000	1.000	PLBL1_HUMAN Phospholipase B-like 1 OS=Homo sapiens OX=9606 GN=PLBD1 PE=1 SV=2
2	Q550U9	7.24e-93	297	574	0.315	0.303	PLBLA_DICDI Phospholipase B-like protein A OS=Dictyostelium discoideum OX=44689 GN=plbA PE=1 SV=1
3	Q8NHP8	4.21e-78	259	589	0.333	0.312	PLBL2_HUMAN Putative phospholipase B-like 2 OS=Homo sapiens OX=9606 GN=PLBD2 PE=1 SV=2
4	Q3TCN2	4.66e-77	256	594	0.322	0.300	PLBL2_MOUSE Putative phospholipase B-like 2 OS=Mus musculus OX=10090 GN=Plbd2 PE=1 SV=2
5	Q9VRK8	1.25e-19	95.1	658	0.188	0.158	PLBL_DROME Putative phospholipase B-like lamina ancestor OS=Drosophila melanogaster OX=7227 GN=lama PE=2 SV=3
6	P36370	0.025	40.0	725	0.076	0.058	TAP1_RAT Antigen peptide transporter 1 OS=Rattus norvegicus OX=10116 GN=Tap1 PE=1 SV=2
7	P21958	0.044	39.3	724	0.061	0.047	TAP1_MOUSE Antigen peptide transporter 1 OS=Mus musculus OX=10090 GN=Tap1 PE=1 SV=3
8	O55081	2.3	33.5	1135	0.040	0.019	RBL2_RAT Retinoblastoma-like protein 2 OS=Rattus norvegicus OX=10116 GN=Rbl2 PE=1 SV=1
9	P22467	5.3	32.3	994	0.056	0.031	MYOA_DICDI Myosin IA heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoA PE=3 SV=2
10	P94983	6.5	31.6	268	0.025	0.052	P94983_MYCTU Probable transmembrane protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1648 PE=4 SV=1
11	M9PI02	7.6	31.6	424	0.038	0.050	M9PI02_DROME Beadex, isoform D OS=Drosophila melanogaster OX=7227 GN=Bx PE=1 SV=1
12	Q04658	8.2	31.6	369	0.042	0.062	SMA2_YEAST Spore membrane assembly protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SMA2 PE=1 SV=1
13	O35874	8.5	31.6	532	0.033	0.034	SATT_MOUSE Neutral amino acid transporter A OS=Mus musculus OX=10090 GN=Slc1a4 PE=1 SV=1
14	Q8IQX7	8.7	31.6	384	0.038	0.055	Q8IQX7_DROME Beadex, isoform B OS=Drosophila melanogaster OX=7227 GN=Bx PE=1 SV=1
15	Q03518	9.7	31.6	748	0.047	0.035	TAP1_HUMAN Antigen peptide transporter 1 OS=Homo sapiens OX=9606 GN=TAP1 PE=1 SV=3
16	X5CKB3	9.7	31.6	748	0.047	0.035	X5CKB3_HUMAN ABC-type antigen peptide transporter OS=Homo sapiens OX=9606 GN=TAP1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04916 Phospholip_B	5.5e-182	617.5	Phospholipase B
2	PF10384 Scm3	4.1e+02	12.1	Centromere protein Scm3

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000240617

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000379845	0.756	4-aminobutyrate aminotransferase, mitochondrial
2	9606.ENSP00000203407	0.642	Cytochrome b-c1 complex subunit 1, mitochondrial
3	9606.ENSP00000358857	0.639	Emerin
4	9606.ENSP00000364579	0.595	Growth hormone-regulated TBC protein 1
5	9606.ENSP00000383421	0.573	Splicing regulator RBM11
6	9606.ENSP00000387123	0.570	Alpha-aminoadipic semialdehyde dehydrogenase
7	9606.ENSP00000343331	0.566	Lipase member I
8	9606.ENSP00000229270	0.558	Triosephosphate isomerase 1
9	9606.ENSP00000231420	0.552	Alanine--glyoxylate aminotransferase 2, mitochondrial
10	9606.ENSP00000282878	0.540	Ras-related protein Rab-3C
11	9606.ENSP00000357583	0.537	Type I inositol 1,4,5-trisphosphate 5-phosphatase
12	9606.ENSP00000425658	0.536	Ankyrin repeat domain-containing protein 50
13	9606.ENSP00000249269	0.535	Mitochondrial-processing peptidase subunit beta
14	9606.ENSP00000313921	0.532	Mitochondrial peptide methionine sulfoxide reductase
15	9606.ENSP00000261313	0.531	Phosphatidylethanolamine-binding protein 1
16	9606.ENSP00000356436	0.531	Cytosolic phospholipase A2
17	9606.ENSP00000364361	0.530	Mitogen-activated protein kinase kinase kinase 20
18	9606.ENSP00000423602	0.528	Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide
19	9606.ENSP00000216254	0.526	Aconitate hydratase, mitochondrial
20	9606.ENSP00000244137	0.526	Xaa-Pro dipeptidase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0003824	0.996	catalytic activity
GO:0016787	0.928	hydrolase activity
GO:0004620	0.497	phospholipase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.991	primary metabolic process
GO:0044237	0.990	cellular metabolic process
GO:0006807	0.948	nitrogen compound metabolic process
GO:1901575	0.767	organic substance catabolic process
GO:0006793	0.760	phosphorus metabolic process
GO:1901564	0.741	organonitrogen compound metabolic process
GO:0044281	0.685	small molecule metabolic process
GO:0006796	0.668	phosphate-containing compound metabolic process
GO:0044248	0.601	cellular catabolic process
GO:0019637	0.427	organophosphate metabolic process
GO:0044255	0.317	cellular lipid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.997	extracellular space
GO:0005829	0.997	cytosol
GO:0043227	0.908	membrane-bounded organelle
GO:0043229	0.819	intracellular organelle
GO:0043231	0.804	intracellular membrane-bounded organelle
GO:0070062	0.634	extracellular exosome
GO:0043233	0.612	organelle lumen
GO:0070013	0.499	intracellular organelle lumen
GO:0005634	0.325	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.928	Hydrolases.
EC:3.1.-.-	0.497	Acting on ester bonds.

[back to server]