StarFunc result for job id Q6P4F1

User Input

>input (479 residues)
MVRIQRRKLLASCLCVTATVFLLVTLQVMVELGKFERKEFKSSSLQDGHTKMEEAPTHLN
SFLKKEGLTFNRKRKWELDSYPIMLWWSPLTGETGRLGQCGADACFFTINRTYLHHHMTK
AFLFYGTDFNIDSLPLPRKAHHDWAVFHEESPKNNYKLFHKPVITLFNYTATFSRHSHLP
LTTQYLESIEVLKSLRYLVPLQSKNKLRKRLAPLVYVQSDCDPPSDRDSYVRELMTYIEV
DSYGECLRNKDLPQQLKNPASMDADGFYRIIAQYKFILAFENAVCDDYITEKFWRPLKLG
VVPVYYGSPSITDWLPSNKSAILVSEFSHPRELASYIRRLDSDDRLYEAYVEWKLKGEIS
NQRLLTALRERKWGVQDVNQDNYIDAFECMVCTKVWANIRLQEKGLPPKRWEAEDTHLSC
PEPTVFAFSPLRTPPLSSLREMWISSFEQSKKEAQALRWLVDRNQNFSSQEFWGLVFKD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6P4F1	1.000	1.000	1.622E-95	479	1.000	1.000	Q6P4F1.pdb.gz	FUT10_HUMAN Alpha-(1,3)-fucosyltransferase 10 OS=Homo sapiens OX=9606 GN=FUT10 PE=1 SV=2
2	AFDB:Q5F2L2	0.954	0.950	2.705E-82	481	0.820	0.817	Q5F2L2.pdb.gz	FUT10_MOUSE Alpha-(1,3)-fucosyltransferase 10 OS=Mus musculus OX=10090 GN=Fut10 PE=2 SV=1
3	AFDB:Q495W5	0.796	0.776	1.451E-47	492	0.378	0.368	Q495W5.pdb.gz	FUT11_HUMAN Alpha-(1,3)-fucosyltransferase 11 OS=Homo sapiens OX=9606 GN=FUT11 PE=1 SV=1
4	AFDB:Q9VUL9	0.481	0.461	4.049E-18	503	0.198	0.189	Q9VUL9.pdb.gz	FUCTA_DROME Glycoprotein 3-alpha-L-fucosyltransferase A OS=Drosophila melanogaster OX=7227 GN=FucTA PE=1 SV=2
5	AFDB:O88819	0.458	0.592	1.050E-16	359	0.194	0.259	O88819.pdb.gz	FUT9_MOUSE 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase 9 OS=Mus musculus OX=10090 GN=Fut9 PE=1 SV=1
6	AFDB:Q11128	0.460	0.572	2.084E-16	374	0.192	0.246	Q11128.pdb.gz	FUT5_HUMAN 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase FUT5 OS=Homo sapiens OX=9606 GN=FUT5 PE=1 SV=1
7	AFDB:Q9FX97	0.473	0.445	1.725E-15	513	0.175	0.164	Q9FX97.pdb.gz	FUT12_ARATH Putative fucosyltransferase-like protein OS=Arabidopsis thaliana OX=3702 GN=FUT12 PE=2 SV=1
8	AFDB:Q9LJK1	0.479	0.460	3.424E-15	501	0.163	0.156	Q9LJK1.pdb.gz	FUT11_ARATH Glycoprotein 3-alpha-L-fucosyltransferase A OS=Arabidopsis thaliana OX=3702 GN=FUT11 PE=1 SV=1
9	AFDB:Q9C8W3	0.435	0.504	1.136E-14	401	0.167	0.200	Q9C8W3.pdb.gz	FUT13_ARATH Alpha-(1,4)-fucosyltransferase OS=Arabidopsis thaliana OX=3702 GN=FUT13 PE=2 SV=2
10	AFDB:O30511	0.343	0.343	3.316E-10	478	0.132	0.132	O30511.pdb.gz	FUCT_HELPX Alpha-(1,3)-fucosyltransferase FucT OS=Helicobacter pylori OX=210 GN=fucT PE=1 SV=1
11	PDB:1bgtA	0.287	0.394	6.763E-4	329	0.073	0.106	1bgtA.pdb.gz
12	PDB:2wtxD	0.282	0.292	8.998E-4	457	0.094	0.098	2wtxD.pdb.gz	Mechanistic Insight Into Enzymatic Glycosyl Transfer with Retention of Configuration Through Analysis of Glycomimetic Inhibitors.
13	PDB:1ya6A	0.281	0.338	1.505E-3	380	0.077	0.097	1ya6A.pdb.gz	Structural evidence of a passive base-flipping mechanism for AGT, an unusual GT-B glycosyltransferase.
14	PDB:3s27H	0.344	0.229	1.593E-3	797	0.088	0.053	3s27H.pdb.gz	The Structure of Sucrose Synthase-1 from Arabidopsis thaliana and Its Functional Implications.
15	PDB:1ixyA	0.261	0.338	2.820E-3	351	0.067	0.091	1ixyA.pdb.gz	A Base-flipping Mechanism for the T4 Phage beta-Glucosyltransferase and Identification of a Transition-state Analog
16	PDB:3guhA	0.271	0.272	3.753E-3	477	0.090	0.090	3guhA.pdb.gz	The Crystal Structures of the Open and Catalytically Competent Closed Conformation of Escherichia coli Glycogen Synthase.
17	PDB:5hvoA	0.307	0.318	5.597E-3	459	0.063	0.065	5hvoA.pdb.gz	Structural and In Vivo Studies on Trehalose-6-Phosphate Synthase from Pathogenic Fungi Provide Insights into Its Catalytic Mechanism, Biological Necessity, and Potential for Novel Antifungal Drug Design.
18	PDB:5xvrA	0.209	0.246	6.643E-3	381	0.069	0.087	5xvrA.pdb.gz	Structural basis of protein arginine rhamnosylation by glycosyltransferase EarP
19	PDB:5e9uA	0.250	0.240	7.885E-3	503	0.077	0.074	5e9uA.pdb.gz	Mechanism of a cytosolic O-glycosyltransferase essential for the synthesis of a bacterial adhesion protein.
20	PDB:7au2A	0.286	0.220	8.349E-3	686	0.102	0.071	7au2A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5F2L2	0.0	837	481	0.820	0.817	FUT10_MOUSE Alpha-(1,3)-fucosyltransferase 10 OS=Mus musculus OX=10090 GN=Fut10 PE=2 SV=1
2	Q6P4F1	0.0	999	479	1.000	1.000	FUT10_HUMAN Alpha-(1,3)-fucosyltransferase 10 OS=Homo sapiens OX=9606 GN=FUT10 PE=1 SV=2
3	Q495W5	5.51e-108	331	492	0.372	0.362	FUT11_HUMAN Alpha-(1,3)-fucosyltransferase 11 OS=Homo sapiens OX=9606 GN=FUT11 PE=1 SV=1
4	Q9VUL9	3.70e-24	107	503	0.177	0.169	FUCTA_DROME Glycoprotein 3-alpha-L-fucosyltransferase A OS=Drosophila melanogaster OX=7227 GN=FucTA PE=1 SV=2
5	G5EFP5	3.65e-21	97.4	400	0.165	0.198	FUTC_CAEEL Alpha-(1,3)-fucosyltransferase fut-3 OS=Caenorhabditis elegans OX=6239 GN=fut-3 PE=1 SV=1
6	Q99JB3	2.34e-20	94.4	359	0.186	0.248	FUT9_RAT 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase 9 OS=Rattus norvegicus OX=10116 GN=Fut9 PE=1 SV=1
7	O88819	5.73e-20	93.6	359	0.167	0.223	FUT9_MOUSE 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase 9 OS=Mus musculus OX=10090 GN=Fut9 PE=1 SV=1
8	Q9Y231	1.80e-19	92.0	359	0.165	0.220	FUT9_HUMAN 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase 9 OS=Homo sapiens OX=9606 GN=FUT9 PE=1 SV=2
9	Q712G6	4.93e-17	84.7	370	0.173	0.224	FUT7_RAT Alpha-(1,3)-fucosyltransferase 7 OS=Rattus norvegicus OX=10116 GN=Fut7 PE=1 SV=1
10	P51993	7.62e-17	84.0	359	0.167	0.223	FUT6_HUMAN 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase FUT6 OS=Homo sapiens OX=9606 GN=FUT6 PE=1 SV=1
11	Q11131	9.65e-17	84.0	389	0.177	0.219	FUT7_MOUSE Alpha-(1,3)-fucosyltransferase 7 OS=Mus musculus OX=10090 GN=Fut7 PE=1 SV=1
12	Q9C8W3	2.93e-16	82.8	401	0.113	0.135	FUT13_ARATH Alpha-(1,4)-fucosyltransferase OS=Arabidopsis thaliana OX=3702 GN=FUT13 PE=2 SV=2
13	G5EDR5	9.57e-16	81.6	433	0.146	0.162	FUTA_CAEEL Alpha-(1,3)-fucosyltransferase fut-1 OS=Caenorhabditis elegans OX=6239 GN=fut-1 PE=1 SV=1
14	Q6P7E6	1.55e-15	80.1	359	0.190	0.253	Q6P7E6_HUMAN Fucosyltransferase OS=Homo sapiens OX=9606 GN=FUT6 PE=1 SV=1
15	Q9P1W6	3.40e-15	79.3	361	0.169	0.224	Q9P1W6_HUMAN Fucosyltransferase OS=Homo sapiens OX=9606 GN=FUT3 PE=2 SV=1
16	P21217	4.13e-15	79.0	361	0.169	0.224	FUT3_HUMAN 3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase FUT3 OS=Homo sapiens OX=9606 GN=FUT3 PE=1 SV=1
17	Q11130	4.96e-15	78.6	342	0.169	0.237	FUT7_HUMAN Alpha-(1,3)-fucosyltransferase 7 OS=Homo sapiens OX=9606 GN=FUT7 PE=1 SV=1
18	Q11128	6.00e-15	78.6	374	0.154	0.198	FUT5_HUMAN 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase FUT5 OS=Homo sapiens OX=9606 GN=FUT5 PE=1 SV=1
19	G3MZR2	1.21e-14	77.4	342	0.159	0.222	FUT7_BOVIN Alpha-(1,3)-fucosyltransferase 7 OS=Bos taurus OX=9913 GN=FUT7 PE=1 SV=2
20	Q9LJK1	1.33e-14	78.2	501	0.129	0.124	FUT11_ARATH Glycoprotein 3-alpha-L-fucosyltransferase A OS=Arabidopsis thaliana OX=3702 GN=FUT11 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00852 Glyco_transf_10	2.1e-33	127.0	Glycosyltransferase family 10 (fucosyltransferase) C-term
2	PF17039 Glyco_tran_10_N	4.3e-08	45.0	Fucosyltransferase, N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000332757

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000339613	0.812	GDP-fucose protein O-fucosyltransferase 2
2	9606.ENSP00000353910	0.752	Alpha-(1,6)-fucosyltransferase
3	9606.ENSP00000364902	0.703	GDP-fucose protein O-fucosyltransferase 1
4	9606.ENSP00000002596	0.639	Heparan sulfate glucosamine 3-O-sulfotransferase 1
5	9606.ENSP00000317027	0.634	Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 4
6	9606.ENSP00000236709	0.631	Alpha-1,4-N-acetylglucosaminyltransferase
7	9606.ENSP00000379377	0.613	Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3
8	9606.ENSP00000321874	0.561	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3
9	9606.ENSP00000312021	0.545	Galactoside 2-alpha-L-fucosyltransferase 1
10	9606.ENSP00000401878	0.533	Kelch repeat and BTB domain-containing protein 8
11	9606.ENSP00000368917	0.516	N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase
12	9606.ENSP00000387498	0.515	Galactoside 2-alpha-L-fucosyltransferase 2
13	9606.ENSP00000353246	0.509	Protein MAK16 homolog
14	9606.ENSP00000385735	0.500	Galactosylceramide sulfotransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046920	1.000	alpha-(1->3)-fucosyltransferase activity
GO:0005515	0.663	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0070085	0.991	glycosylation
GO:1901576	0.990	organic substance biosynthetic process
GO:0044237	0.986	cellular metabolic process
GO:0006486	0.972	protein glycosylation
GO:0005975	0.303	carbohydrate metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	1.000	Golgi apparatus
GO:0070013	0.998	intracellular organelle lumen
GO:0005654	0.986	nucleoplasm
GO:0005783	0.978	endoplasmic reticulum
GO:0016020	0.966	membrane
GO:0031090	0.844	organelle membrane
GO:0098588	0.696	bounding membrane of organelle
GO:0000139	0.694	Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.

[back to server]