StarFunc result for job id Q6P4F2

User Input

>input (186 residues)
MHVMAASMARGGVSARVLLQAARGTWWNRPGGTSGSGEGVALGTTRKFQATGSRPAGEED
AGGPERPGDVVNVVFVDRSGQRIPVSGRVGDNVLHLAQRHGVDLEGACEASLACSTCHVY
VSEDHLDLLPPPEEREDDMLDMAPLLQENSRLGCQIVLTPELEGAEFTLPKITRNFYVDG
HVPKPH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6P4F2	1.000	1.000	2.039E-36	186	1.000	1.000	Q6P4F2.pdb.gz	FDX2_HUMAN Ferredoxin-2, mitochondrial OS=Homo sapiens OX=9606 GN=FDX2 PE=1 SV=2
2	AFDB:Q9CPW2	0.669	0.714	1.302E-29	174	0.785	0.839	Q9CPW2.pdb.gz	FDX2_MOUSE Ferredoxin-2, mitochondrial OS=Mus musculus OX=10090 GN=Fdx2 PE=1 SV=1
3	AFDB:P37193	0.674	0.727	2.352E-22	172	0.478	0.517	P37193.pdb.gz	ADXH1_DROME Adrenodoxin-like protein 1, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Fdx1 PE=2 SV=3
4	AFDB:Q9M0V0	0.613	0.579	2.845E-17	197	0.376	0.355	Q9M0V0.pdb.gz	MFDX1_ARATH Adrenodoxin-like protein 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MFDX1 PE=1 SV=1
5	AFDB:Q8S904	0.617	0.583	4.484E-17	197	0.371	0.350	Q8S904.pdb.gz	MFDX2_ARATH Adrenodoxin-like protein 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MFDX2 PE=2 SV=1
6	AFDB:Q12184	0.609	0.657	6.880E-16	172	0.328	0.355	Q12184.pdb.gz	ADRX_YEAST Adrenodoxin homolog, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YAH1 PE=1 SV=1
7	AFDB:P10109	0.581	0.587	2.304E-14	184	0.301	0.304	P10109.pdb.gz	ADX_HUMAN Adrenodoxin, mitochondrial OS=Homo sapiens OX=9606 GN=FDX1 PE=1 SV=1
8	AFDB:P00257	0.586	0.586	5.026E-14	186	0.290	0.290	P00257.pdb.gz	ADX_BOVIN Adrenodoxin, mitochondrial OS=Bos taurus OX=9913 GN=FDX1 PE=1 SV=2
9	AFDB:P24483	0.569	0.563	6.109E-14	188	0.290	0.287	P24483.pdb.gz	ADX_RAT Adrenodoxin, mitochondrial OS=Rattus norvegicus OX=10116 GN=Fdx1 PE=2 SV=1
10	AFDB:Q8SZA8	0.570	0.691	1.729E-13	152	0.280	0.342	Q8SZA8.pdb.gz	ADXH2_DROME Adrenodoxin-like protein 2, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Fdx2 PE=2 SV=1
11	PDB:6nblD	0.539	0.924	1.004E-10	107	0.220	0.383	6nblD.pdb.gz	Ligand and Redox Partner Binding Generates a New Conformational State in Cytochrome P450cam (CYP101A1).
12	PDB:7m8iA	0.519	0.173	2.840E-10	572	0.210	0.068	7m8iA.pdb.gz	Structural and functional insights into aldosterone synthase interaction with its redox partner protein adrenodoxin.
13	PDB:1i7hA	0.516	0.853	3.931E-10	109	0.215	0.367	1i7hA.pdb.gz	Crystal structure of Escherichia coli Fdx, an adrenodoxin-type ferredoxin involved in the assembly of iron-sulfur clusters.
14	PDB:7aqqO	0.550	0.810	1.997E-9	122	0.183	0.279	7aqqO.pdb.gz	A ferredoxin bridge connects the two arms of plant mitochondrial complex I.
15	PDB:1czpA	0.348	0.624	1.436E-4	98	0.091	0.173	1czpA.pdb.gz	Refined X-ray structures of the oxidized, at 1.3 A, and reduced, at 1.17 A, [2Fe-2S] ferredoxin from the cyanobacterium Anabaena PCC7119 show redox-linked conformational changes.
16	PDB:6khi1	0.365	0.659	1.636E-4	98	0.102	0.194	6khi1.pdb.gz	Structural basis for electron transport mechanism of complex I-like photosynthetic NAD(P)H dehydrogenase.
17	PDB:5frtA	0.374	0.561	3.344E-4	119	0.097	0.151	5frtA.pdb.gz	Structure of Fesi Protein from Azotobacter Vinelandii
18	PDB:7wffc	0.427	0.588	4.939E-4	128	0.151	0.219	7wffc.pdb.gz	Supramolecular assembly of chloroplast NADH dehydrogenase-like complex with photosystem I from Arabidopsis thaliana.
19	PDB:5aukA	0.357	0.656	5.625E-4	96	0.091	0.177	5aukA.pdb.gz	X-ray Structure and Nuclear Magnetic Resonance Analysis of the Interaction Sites of the Ga-Substituted Cyanobacterial Ferredoxin
20	PDB:7xk3F	0.337	0.166	7.296E-4	408	0.097	0.044	7xk3F.pdb.gz	Cryo-EM structures of Na + -pumping NADH-ubiquinone oxidoreductase from Vibrio cholerae.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6P4F2	9.35e-137	381	186	1.000	1.000	FDX2_HUMAN Ferredoxin-2, mitochondrial OS=Homo sapiens OX=9606 GN=FDX2 PE=1 SV=2
2	Q9CPW2	5.58e-98	282	174	0.785	0.839	FDX2_MOUSE Ferredoxin-2, mitochondrial OS=Mus musculus OX=10090 GN=Fdx2 PE=1 SV=1
3	P37193	3.71e-59	184	172	0.446	0.483	ADXH1_DROME Adrenodoxin-like protein 1, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Fdx1 PE=2 SV=3
4	Q9M0V0	1.52e-38	132	197	0.333	0.315	MFDX1_ARATH Adrenodoxin-like protein 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MFDX1 PE=1 SV=1
5	Q8S904	6.98e-36	125	197	0.323	0.305	MFDX2_ARATH Adrenodoxin-like protein 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MFDX2 PE=2 SV=1
6	Q12184	1.22e-29	109	172	0.269	0.291	ADRX_YEAST Adrenodoxin homolog, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YAH1 PE=1 SV=1
7	Q8SZA8	1.13e-25	98.6	152	0.263	0.322	ADXH2_DROME Adrenodoxin-like protein 2, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Fdx2 PE=2 SV=1
8	Q10361	2.51e-24	101	616	0.296	0.089	ETP1_SCHPO Electron transfer protein 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=etp1 PE=1 SV=2
9	E7F7J1	2.06e-22	90.5	175	0.263	0.280	E7F7J1_DANRE Adrenodoxin OS=Danio rerio OX=7955 GN=fdx1 PE=1 SV=1
10	P10109	4.86e-21	87.4	184	0.231	0.234	ADX_HUMAN Adrenodoxin, mitochondrial OS=Homo sapiens OX=9606 GN=FDX1 PE=1 SV=1
11	P00257	6.71e-21	87.0	186	0.231	0.231	ADX_BOVIN Adrenodoxin, mitochondrial OS=Bos taurus OX=9913 GN=FDX1 PE=1 SV=2
12	P24483	1.24e-18	81.3	188	0.231	0.229	ADX_RAT Adrenodoxin, mitochondrial OS=Rattus norvegicus OX=10116 GN=Fdx1 PE=2 SV=1
13	P46656	1.30e-18	81.3	188	0.220	0.218	ADX_MOUSE Adrenodoxin, mitochondrial OS=Mus musculus OX=10090 GN=Fdx1 PE=1 SV=1
14	Q584K7	1.59e-16	75.1	167	0.237	0.263	Q584K7_TRYB2 Adrenodoxin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.3M17.330 PE=4 SV=1
15	P00259	2.71e-16	72.8	107	0.220	0.383	PUTX_PSEPU Putidaredoxin OS=Pseudomonas putida OX=303 GN=camB PE=1 SV=3
16	A2BGD1	9.02e-16	73.2	168	0.210	0.232	A2BGD1_DANRE Ferredoxin 1b OS=Danio rerio OX=7955 GN=si:rp71-5c20.1 PE=1 SV=2
17	D5IGG4	9.82e-14	66.2	109	0.237	0.404	CARAC_SPHSX Ferredoxin CarAc OS=Sphingomonas sp. OX=28214 GN=carAc PE=1 SV=1
18	P0A9R4	1.02e-13	66.2	111	0.215	0.360	FER_ECOLI 2Fe-2S ferredoxin OS=Escherichia coli (strain K12) OX=83333 GN=fdx PE=1 SV=2
19	Q9SRR8	1.06e-06	48.5	159	0.215	0.252	Q9SRR8_ARATH 2Fe-2S ferredoxin-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=F21O3.19 PE=1 SV=1
20	Q9P7P0	0.025	37.4	675	0.151	0.041	YOL4_SCHPO Uncharacterized acyltransferase C1718.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1718.04 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00111 Fer2	1e-06	39.9	2Fe-2S iron-sulfur cluster binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000014776

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000008273	0.942	Iron-sulfur cluster assembly enzyme
2	61853.ENSNLEP00000012849	0.934	NADPH:adrenodoxin oxidoreductase, mitochondrial
3	61853.ENSNLEP00000012596	0.916	NFS1 cysteine desulfurase
4	61853.ENSNLEP00000013604	0.813	Selenocysteine lyase
5	61853.ENSNLEP00000002849	0.806	HscB mitochondrial iron-sulfur cluster co-chaperone
6	61853.ENSNLEP00000013948	0.789	LYR motif containing 4
7	61853.ENSNLEP00000010038	0.742	Phosphatidylinositol-4-phosphate 5-kinase, type I, beta
8	61853.ENSNLEP00000006215	0.702	Iron-sulfur cluster assembly 1
9	61853.ENSNLEP00000011120	0.645	NADPH-dependent diflavin oxidoreductase 1
10	61853.ENSNLEP00000019730	0.634	Iron-sulfur cluster assembly 2
11	61853.ENSNLEP00000012318	0.616	NFU1 iron-sulfur cluster scaffold
12	61853.ENSNLEP00000009229	0.613	Cytochrome b-c1 complex subunit Rieske, mitochondrial
13	61853.ENSNLEP00000017322	0.611	IBA57, iron-sulfur cluster assembly homolog (S. cerevisiae)
14	61853.ENSNLEP00000020772	0.605	Lipoyl synthase, mitochondrial
15	61853.ENSNLEP00000016581	0.591	Ubiquinone biosynthesis O-methyltransferase, mitochondrial
16	61853.ENSNLEP00000000385	0.576	bolA family member 3
17	61853.ENSNLEP00000000570	0.568	Glutaredoxin 5
18	61853.ENSNLEP00000017490	0.563	Succinate dehydrogenase complex, subunit C, integral membrane protein, 15kDa
19	61853.ENSNLEP00000016091	0.544	Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
20	61853.ENSNLEP00000019583	0.534	Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0009055	1.000	electron transfer activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.999	cellular metabolic process
GO:0016226	0.992	iron-sulfur cluster assembly
GO:0071704	0.762	organic substance metabolic process
GO:0044238	0.402	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.998	intracellular organelle lumen
GO:0005759	0.962	mitochondrial matrix
GO:0031981	0.420	nuclear lumen
GO:0005654	0.393	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.-.-.-	1.000	Oxidoreductases.

[back to server]