StarFunc result for job id Q6P4F7

User Input

>input (1023 residues)
MWDQRLVRLALLQHLRAFYGIKVKGVRGQCDRRRHETAATEIGGKIFGVPFNALPHSAVP
EYGHIPSFLVDACTSLEDHIHTEGLFRKSGSVIRLKALKNKVDHGEGCLSSAPPCDIAGL
LKQFFRELPEPILPADLHEALLKAQQLGTEEKNKATLLLSCLLADHTVHVLRYFFNFLRN
VSLRSSENKMDSSNLAVIFAPNLLQTSEGHEKMSSNTEKKLRLQAAVVQTLIDYASDIGR
VPDFILEKIPAMLGIDGLCATPSLEGFEEGEYETPGEYKRKRRQSVGDFVSGALNKFKPN
RTPSITPQEERIAQLSESPVILTPNAKRTLPVDSSHGFSSKKRKSIKHNFNFELLPSNLF
NSSSTPVSVHIDTSSEGSSQSSLSPVLIGGNHLITAGVPRRSKRIAGKKVCRVESGKAGC
FSPKISHKEKVRRSLRLKFNLGKNGREVNGCSGVNRYESVGWRLANQQSLKNRIESVKTG
LLFSPDVDEKLPKKGSEKISKSEETLLTPERLVGTNYRMSWTGPNNSSFQEVDANEASSM
VENLEVENSLEPDIMVEKSPATSCELTPSNLNNKHNSNITSSPLSGDENNMTKETLVKVQ
KAFSESGSNLHALMNQRQSSVTNVGKVKLTEPSYLEDSPEENLFETNDLTIVESKEKYEH
HTGKGEKCFSERDFSPLQTQTFNRETTIKCYSTQMKMEHEKDIHSNMPKDYLSKQEFSSD
EEIKKQQSPKDKLNNKLKENENMMEGNLPKCAAHSKDEARSSFSQQSTCVVTNLSKPRPM
RIAKQQSLETCEKTVSESSQMTEHRKVSDHIQWFNKLSLNEPNRIKVKSPLKFQRTPVRQ
SVRRINSLLEYSRQPTGHKLASLGDTASPLVKSVSCDGALSSCIESASKDSSVSCIKSGP
KEQKSMSCEESNIGAISKSSMELPSKSFLKMRKHPDSVNASLRSTTVYKQKILSDGQVKV
PLDDLTNHDIVKPVVNNNMGISSGINNRVLRRPSERGRAWYKGSPKHPIGKTQLLPTSKP
VDL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6P4F7	0.999	0.999	0.000	1023	1.000	1.000	Q6P4F7.pdb.gz	RHGBA_HUMAN Rho GTPase-activating protein 11A OS=Homo sapiens OX=9606 GN=ARHGAP11A PE=1 SV=2
2	AFDB:A0A0A0MRJ9	0.174	0.198	3.615E-11	890	0.137	0.157	A0A0A0MRJ9.pdb.gz	A0A0A0MRJ9_HUMAN Rho GTPase activating protein 30 OS=Homo sapiens OX=9606 GN=ARHGAP30 PE=1 SV=1
3	AFDB:D4A9G6	0.185	0.147	4.551E-11	1310	0.164	0.128	D4A9G6.pdb.gz	D4A9G6_RAT Rho GTPase activating protein 33 OS=Rattus norvegicus OX=10116 GN=Arhgap33 PE=1 SV=4
4	AFDB:X2JEI9	0.176	0.083	1.731E-10	2206	0.158	0.073	X2JEI9.pdb.gz	X2JEI9_DROME Rho GTPase activating protein at 19D, isoform D OS=Drosophila melanogaster OX=7227 GN=RhoGAP19D PE=1 SV=1
5	AFDB:Q2M1Z3	0.165	0.119	1.988E-10	1444	0.197	0.140	Q2M1Z3.pdb.gz	RHG31_HUMAN Rho GTPase-activating protein 31 OS=Homo sapiens OX=9606 GN=ARHGAP31 PE=1 SV=2
6	AFDB:A7KAX9	0.195	0.100	2.082E-10	2087	0.193	0.094	A7KAX9.pdb.gz	RHG32_HUMAN Rho GTPase-activating protein 32 OS=Homo sapiens OX=9606 GN=ARHGAP32 PE=1 SV=1
7	AFDB:Q9VIS1	0.190	0.111	3.968E-10	1843	0.171	0.095	Q9VIS1.pdb.gz	CDGAP_DROME GTPase-activating protein CdGAPr OS=Drosophila melanogaster OX=7227 GN=CdGAPr PE=1 SV=2
8	AFDB:F1MAK3	0.204	0.107	4.771E-10	2101	0.179	0.087	F1MAK3.pdb.gz	F1MAK3_RAT Rho GTPase activating protein 32 OS=Rattus norvegicus OX=10116 GN=Arhgap32 PE=1 SV=2
9	AFDB:A6X8Z5	0.171	0.125	6.897E-10	1425	0.185	0.133	A6X8Z5.pdb.gz	RHG31_MOUSE Rho GTPase-activating protein 31 OS=Mus musculus OX=10090 GN=Arhgap31 PE=1 SV=1
10	AFDB:Q5T5U3	0.176	0.095	1.509E-9	1958	0.151	0.079	Q5T5U3.pdb.gz	RHG21_HUMAN Rho GTPase-activating protein 21 OS=Homo sapiens OX=9606 GN=ARHGAP21 PE=1 SV=2
11	PDB:6r3vA	0.165	0.780	3.674E-9	198	0.059	0.303	6r3vA.pdb.gz	A GAP-GTPase-GDP-PiIntermediate Crystal Structure Analyzed by DFT Shows GTP Hydrolysis Involves Serial Proton Transfers.
12	PDB:3cxlA	0.154	0.382	5.567E-8	402	0.043	0.109	3cxlA.pdb.gz	Crystal structure of human chimerin 1 (CHN1).
13	PDB:5jcpA	0.166	0.454	1.276E-7	361	0.042	0.119	5jcpA.pdb.gz	Structural Basis for the Specific Recognition of RhoA by the Dual GTPase-activating Protein ARAP3
14	PDB:1xa6A	0.169	0.418	1.606E-7	399	0.049	0.125	1xa6A.pdb.gz	Structural mechanism for lipid activation of the Rac-specific GAP, beta2-chimaerin.
15	PDB:5c2kA	0.170	0.433	2.220E-6	382	0.047	0.126	5c2kA.pdb.gz	Structural basis of G-protein target alternation of MgcRacGAP by phospholylation
16	PDB:1yvpB	0.049	0.075	4.883E-1	532	0.032	0.062	1yvpB.pdb.gz	Structural Insights into RNA Quality Control: The Ro Autoantigen Binds Misfolded RNAs via Its Central Cavity
17	PDB:6sgaFA	0.044	0.071	4.883E-1	579	0.027	0.048	6sgaFA.pdb.gz	Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.
18	PDB:6gmlU	0.046	0.162	9.745E-1	183	0.018	0.098	6gmlU.pdb.gz	Structure of paused transcription complex Pol II-DSIF-NELF.
19	PDB:7rroYB	0.043	0.139	1.618	219	0.020	0.091	7rroYB.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
20	PDB:6swy8	0.050	0.111	2.037	325	0.030	0.095	6swy8.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6P4F7	0.0	2108	1023	1.000	1.000	RHGBA_HUMAN Rho GTPase-activating protein 11A OS=Homo sapiens OX=9606 GN=ARHGAP11A PE=1 SV=2
2	Q3KRB8	9.15e-154	457	267	0.215	0.824	RHGBB_HUMAN Inactive Rho GTPase-activating protein 11B OS=Homo sapiens OX=9606 GN=ARHGAP11B PE=1 SV=1
3	O01443	1.43e-17	90.9	986	0.060	0.062	O01443_CAEEL Rho-GAP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=rga-6 PE=4 SV=3
4	Q7Z5H3	3.26e-17	89.4	698	0.060	0.087	RHG22_HUMAN Rho GTPase-activating protein 22 OS=Homo sapiens OX=9606 GN=ARHGAP22 PE=1 SV=1
5	Q5VZB4	3.69e-17	87.8	450	0.048	0.109	Q5VZB4_HUMAN SLIT-ROBO Rho GTPase activating protein 2 (Fragment) OS=Homo sapiens OX=9606 GN=SRGAP2 PE=1 SV=1
6	Q8K0Q5	4.75e-17	88.6	663	0.069	0.107	RHG18_MOUSE Rho GTPase-activating protein 18 OS=Mus musculus OX=10090 GN=Arhgap18 PE=1 SV=1
7	O54834	7.89e-17	88.2	987	0.071	0.074	RHG06_MOUSE Rho GTPase-activating protein 6 OS=Mus musculus OX=10090 GN=Arhgap6 PE=1 SV=3
8	E9PCM6	1.23e-16	87.4	768	0.056	0.074	E9PCM6_HUMAN Rho GTPase activating protein 4 OS=Homo sapiens OX=9606 GN=ARHGAP4 PE=1 SV=1
9	O75044	1.41e-16	87.4	1071	0.052	0.049	SRGP2_HUMAN SLIT-ROBO Rho GTPase-activating protein 2 OS=Homo sapiens OX=9606 GN=SRGAP2 PE=1 SV=3
10	B7ZM87	1.43e-16	87.4	1070	0.052	0.050	B7ZM87_HUMAN SLIT-ROBO Rho GTPase activating protein 2 OS=Homo sapiens OX=9606 GN=SRGAP2 PE=1 SV=1
11	P98171	1.80e-16	87.0	946	0.056	0.060	RHG04_HUMAN Rho GTPase-activating protein 4 OS=Homo sapiens OX=9606 GN=ARHGAP4 PE=1 SV=2
12	E7EQN5	1.87e-16	87.0	925	0.056	0.062	E7EQN5_HUMAN Rho GTPase activating protein 4 OS=Homo sapiens OX=9606 GN=ARHGAP4 PE=1 SV=1
13	Q8N392	1.92e-16	86.7	663	0.081	0.125	RHG18_HUMAN Rho GTPase-activating protein 18 OS=Homo sapiens OX=9606 GN=ARHGAP18 PE=1 SV=3
14	Q91Z67	2.02e-16	87.0	1071	0.052	0.049	SRGP2_MOUSE SLIT-ROBO Rho GTPase-activating protein 2 OS=Mus musculus OX=10090 GN=Srgap2 PE=1 SV=2
15	Q9VTU3	2.26e-16	85.5	476	0.063	0.134	RG68F_DROME Rho GTPase-activating protein 68F OS=Drosophila melanogaster OX=7227 GN=RhoGAP68F PE=1 SV=1
16	D4A208	2.70e-16	86.7	1071	0.052	0.049	SRGP2_RAT SLIT-ROBO Rho GTPase-activating protein 2 OS=Rattus norvegicus OX=10116 GN=Srgap2 PE=1 SV=1
17	A0A024R7N1	6.70e-16	85.5	970	0.067	0.071	A0A024R7N1_HUMAN GMIP (Fragment) OS=Homo sapiens OX=9606 GN=GMIP PE=4 SV=1
18	Q9P107	6.70e-16	85.5	970	0.067	0.071	GMIP_HUMAN GEM-interacting protein OS=Homo sapiens OX=9606 GN=GMIP PE=1 SV=2
19	A0A8I6GIQ7	1.18e-15	84.3	770	0.069	0.092	A0A8I6GIQ7_RAT Rho GTPase activating protein 4 OS=Rattus norvegicus OX=10116 GN=Arhgap4 PE=4 SV=1
20	Q8K4G7	1.18e-15	84.3	965	0.079	0.084	Q8K4G7_RAT Rho GTPase activating protein 4 OS=Rattus norvegicus OX=10116 GN=Arhgap4 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00620 RhoGAP	5.1e-28	109.3	RhoGAP domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355090

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000260731	0.948	Kinesin-like protein KIF11
2	9606.ENSP00000302530	0.943	Mitotic checkpoint serine/threonine-protein kinase BUB1
3	9606.ENSP00000356379	0.938	Abnormal spindle-like microcephaly-associated protein
4	9606.ENSP00000412292	0.937	DEP domain-containing protein 1A
5	9606.ENSP00000274026	0.933	Cyclin-A2
6	9606.ENSP00000247191	0.922	Disks large-associated protein 5
7	9606.ENSP00000265148	0.921	Centromere-associated protein E
8	9606.ENSP00000287598	0.921	Mitotic checkpoint serine/threonine-protein kinase BUB1 beta
9	9606.ENSP00000378699	0.917	Cyclin-dependent kinase 1
10	9606.ENSP00000411532	0.915	DNA topoisomerase 2-alpha
11	9606.ENSP00000378356	0.913	Kinesin-like protein KIF20A
12	9606.ENSP00000357643	0.912	Proliferation marker protein Ki-67
13	9606.ENSP00000358813	0.911	Dual specificity protein kinase TTK
14	9606.ENSP00000362146	0.897	Borealin
15	9606.ENSP00000324020	0.890	Kinesin-like protein KIF15
16	9606.ENSP00000286398	0.885	Structural maintenance of chromosomes protein 2
17	9606.ENSP00000360540	0.879	Centrosomal protein of 55 kDa
18	9606.ENSP00000261597	0.877	Kinetochore protein NDC80 homolog
19	9606.ENSP00000353770	0.875	Ribonucleoside-diphosphate reductase subunit M2
20	9606.ENSP00000355922	0.869	Centromere protein F

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005096	1.000	GTPase activator activity
GO:0005515	0.959	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0051056	0.948	regulation of small GTPase mediated signal transduction
GO:0050790	0.938	regulation of catalytic activity
GO:0044093	0.929	positive regulation of molecular function
GO:0043087	0.904	regulation of GTPase activity
GO:0051345	0.901	positive regulation of hydrolase activity
GO:0043547	0.883	positive regulation of GTPase activity
GO:0009987	0.764	cellular process
GO:0007049	0.320	cell cycle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005634	1.000	nucleus
GO:0043232	0.955	intracellular non-membrane-bounded organelle
GO:0070013	0.949	intracellular organelle lumen
GO:0005654	0.935	nucleoplasm
GO:0005856	0.604	cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]