StarFunc result for job id Q6P4H8

User Input

>input (233 residues)
MEGGGGIPLETLKEESQSRHVLPASFEVNSLQKSNWGFLLTGLVGGTLVAVYAVATPFVT
PALRKVCLPFVPATTKQIENVVKMLRCRRGSLVDIGSGDGRIVIAAAKKGFTAVGYELNP
WLVWYSRYRAWREGVHGSAKFYISDLWKVTFSQYSNVVIFGVPQMMLQLEKKLERELEDD
ARVIACRFPFPHWTPDHVTGEGIDTVWAYDASTFRGREKRPCTSMHFQLPIQA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6P4H8	1.000	1.000	7.015E-50	233	1.000	1.000	Q6P4H8.pdb.gz	ACKMT_HUMAN ATP synthase subunit C lysine N-methyltransferase OS=Homo sapiens OX=9606 GN=ATPSCKMT PE=1 SV=2
2	AFDB:Q9D1Z3	0.696	0.660	1.087E-37	247	0.734	0.692	Q9D1Z3.pdb.gz	ACKMT_MOUSE ATP synthase subunit C lysine N-methyltransferase OS=Mus musculus OX=10090 GN=Atpsckmt PE=1 SV=1
3	AFDB:Q9BQD7	0.611	0.606	1.118E-22	235	0.386	0.383	Q9BQD7.pdb.gz	ANKMT_HUMAN Adenine nucleotide translocase lysine N-methyltransferase OS=Homo sapiens OX=9606 GN=ANTKMT PE=1 SV=1
4	AFDB:Q9XX11	0.690	0.837	2.220E-21	190	0.348	0.426	Q9XX11.pdb.gz	ACKMT_CAEEL ATP synthase subunit C lysine N-methyltransferase OS=Caenorhabditis elegans OX=6239 GN=Y39A1A.21 PE=1 SV=2
5	AFDB:F0NBH8	0.583	0.828	1.402E-14	161	0.189	0.273	F0NBH8.pdb.gz	KMT_SULIR Protein-lysine N-methyltransferase OS=Sulfolobus islandicus (strain REY15A) OX=930945 GN=SiRe_1449 PE=1 SV=1
6	PDB:5jwjA	0.532	0.741	3.482E-12	162	0.189	0.272	5jwjA.pdb.gz
7	AFDB:Q389B6	0.427	0.377	7.029E-9	268	0.120	0.104	Q389B6.pdb.gz	Q389B6_TRYB2 Rhodanese domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.389.1470 PE=4 SV=1
8	PDB:2xvaA	0.422	0.486	8.472E-9	199	0.120	0.141	2xvaA.pdb.gz	Structure and Mechanism of the Chalcogen Detoxifying Protein Tehb from Escherichia Coli.
9	AFDB:P25397	0.439	0.507	2.121E-8	197	0.112	0.132	P25397.pdb.gz	TEHB_ECOLI Tellurite methyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=tehB PE=1 SV=1
10	AFDB:W5U2K2	0.429	0.350	2.264E-8	289	0.120	0.097	W5U2K2.pdb.gz	NMT_CATRO 3-hydroxy-16-methoxy-2,3-dihydrotabersonine N-methyltransferase OS=Catharanthus roseus OX=4058 GN=NMT PE=1 SV=1
11	AFDB:P0A8T1	0.472	0.384	3.807E-8	293	0.116	0.092	P0A8T1.pdb.gz	PRMA_ECOLI Ribosomal protein L11 methyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=prmA PE=1 SV=1
12	AFDB:Q0WP12	0.440	0.451	4.626E-8	227	0.163	0.167	Q0WP12.pdb.gz	HOL1_ARATH Thiocyanate methyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=HOL1 PE=1 SV=2
13	PDB:7bggA	0.414	0.444	1.140E-7	216	0.129	0.139	7bggA.pdb.gz	Structural basis of O-methylation of (2-heptyl-)1-hydroxyquinolin-4(1H)-one and related compounds by the heterocyclic toxin methyltransferase Rv0560c of Mycobacterium tuberculosis.
14	PDB:4hh4C	0.430	0.395	1.478E-7	256	0.094	0.086	4hh4C.pdb.gz	Structure and possible mechanism of the CcbJ methyltransferase from Streptomyces caelestis.
15	PDB:3cjtA	0.506	0.467	2.182E-7	254	0.142	0.130	3cjtA.pdb.gz	Multiple-Site Trimethylation of Ribosomal Protein L11 by the PrmA Methyltransferase.
16	PDB:6jclG	0.447	0.473	2.652E-7	219	0.124	0.132	6jclG.pdb.gz	Structural and biochemical characterization of Rv0187, an O-methyltransferase from Mycobacterium tuberculosis.
17	PDB:3bxoA	0.377	0.372	3.439E-7	236	0.116	0.114	3bxoA.pdb.gz	Three-Dimensional Structure of DesVI from Streptomyces venezuelae: A Sugar N,N-Dimethyltransferase Required for dTDP-Desosamine Biosynthesis.
18	PDB:3lccA	0.434	0.465	3.439E-7	216	0.124	0.134	3lccA.pdb.gz	Halomethane Biosynthesis: Structure of a SAM-Dependent Halide Methyltransferase from Arabidopsis thaliana
19	PDB:1x19A	0.427	0.291	4.460E-7	350	0.082	0.054	1x19A.pdb.gz
20	PDB:3vc1D	0.403	0.331	4.460E-7	288	0.086	0.069	3vc1D.pdb.gz	Structure of Geranyl Diphosphate C-Methyltransferase from Streptomyces coelicolor and Implications for the Mechanism of Isoprenoid Modification.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6P4H8	6.46e-176	484	233	1.000	1.000	ACKMT_HUMAN ATP synthase subunit C lysine N-methyltransferase OS=Homo sapiens OX=9606 GN=ATPSCKMT PE=1 SV=2
2	Q9D1Z3	1.77e-118	339	247	0.734	0.692	ACKMT_MOUSE ATP synthase subunit C lysine N-methyltransferase OS=Mus musculus OX=10090 GN=Atpsckmt PE=1 SV=1
3	Q9XX11	5.75e-49	160	190	0.348	0.426	ACKMT_CAEEL ATP synthase subunit C lysine N-methyltransferase OS=Caenorhabditis elegans OX=6239 GN=Y39A1A.21 PE=1 SV=2
4	Q9BQD7	4.83e-48	160	235	0.399	0.396	ANKMT_HUMAN Adenine nucleotide translocase lysine N-methyltransferase OS=Homo sapiens OX=9606 GN=ANTKMT PE=1 SV=1
5	F0NBH8	5.86e-14	69.3	161	0.193	0.280	KMT_SULIR Protein-lysine N-methyltransferase OS=Sulfolobus islandicus (strain REY15A) OX=930945 GN=SiRe_1449 PE=1 SV=1
6	P9WKL5	9.30e-05	44.7	241	0.094	0.091	HTM_MYCTU 2-heptyl-1-hydroxyquinolin-4(1H)-one methyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=htm PE=1 SV=1
7	Q389B6	0.036	37.0	268	0.082	0.071	Q389B6_TRYB2 Rhodanese domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.389.1470 PE=4 SV=1
8	W5U2K2	0.22	34.7	289	0.094	0.076	NMT_CATRO 3-hydroxy-16-methoxy-2,3-dihydrotabersonine N-methyltransferase OS=Catharanthus roseus OX=4058 GN=NMT PE=1 SV=1
9	P26236	0.34	33.9	224	0.082	0.085	BCHM_RHOCA Magnesium-protoporphyrin O-methyltransferase OS=Rhodobacter capsulatus OX=1061 GN=bchM PE=1 SV=1
10	Q84BQ9	1.00	32.3	254	0.069	0.063	PRMA_THET8 Ribosomal protein L11 methyltransferase OS=Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) OX=300852 GN=prmA PE=1 SV=2
11	O69687	3.1	31.2	427	0.137	0.075	FAMT_MYCTU Probable fatty acid methyltransferase Rv3720 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv3720 PE=1 SV=4
12	Q9UPM9	3.1	30.8	204	0.099	0.113	B9D1_HUMAN B9 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=B9D1 PE=1 SV=1
13	Q17307	3.7	31.2	1489	0.167	0.026	TRA2_CAEBR Sex-determining transformer protein 2 OS=Caenorhabditis briggsae OX=6238 GN=tra-2 PE=1 SV=3
14	O76027	4.3	30.8	345	0.056	0.038	ANXA9_HUMAN Annexin A9 OS=Homo sapiens OX=9606 GN=ANXA9 PE=1 SV=3
15	Q57WQ9	4.7	30.8	830	0.073	0.020	Q57WQ9_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.27M11.690 PE=4 SV=1
16	Q54M12	5.1	30.8	1091	0.064	0.014	Q54M12_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0286269 PE=4 SV=1
17	Q9UZR7	5.9	30.4	405	0.103	0.059	ATRMA_PYRAB tRNA (uracil(54)-C(5))-methyltransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) OX=272844 GN=PYRAB10780 PE=1 SV=1
18	G5EBV8	6.7	30.4	937	0.077	0.019	G5EBV8_CAEEL Ion transport domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=osm-9 PE=2 SV=1
19	O18235	6.8	30.0	268	0.073	0.063	O18235_CAEEL Ubiquinone biosynthesis O-methyltransferase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=coq-3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07757 AdoMet_MTase	5.4e+02	12.2	Predicted AdoMet-dependent methyltransferase
2	PF03706 LPG_synthase_TM	73	14.4	Lysylphosphatidylglycerol synthase TM region
3	PF13489 Methyltransf_23	2.7	19.2	Methyltransferase domain
4	PF13649 Methyltransf_25	11	18.1	Methyltransferase domain
5	PF05175 MTS	3.7e+02	12.1	Methyltransferase small domain
6	PF06325 PrmA	7.1e+02	11.0	Ribosomal protein L11 methyltransferase (PrmA)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000422338

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000296658	0.876	Carboxymethylenebutenolidase homolog
2	9606.ENSP00000307975	0.772	Histidine protein methyltransferase 1 homolog
3	9606.ENSP00000372206	0.771	EEF1A lysine methyltransferase 1
4	9606.ENSP00000280326	0.759	T-complex protein 1 subunit epsilon
5	9606.ENSP00000350353	0.754	Electron transfer flavoprotein beta subunit lysine methyltransferase
6	9606.ENSP00000379201	0.748	Protein-lysine methyltransferase METTL21D
7	9606.ENSP00000415115	0.742	Protein N-lysine methyltransferase METTL21A
8	9606.ENSP00000357829	0.737	EEF1A lysine methyltransferase 2
9	9606.ENSP00000371345	0.729	Methyltransferase-like protein 22
10	9606.ENSP00000354920	0.725	Methyltransferase-like protein 13
11	9606.ENSP00000398502	0.697	Protein-lysine N-methyltransferase EEF2KMT
12	9606.ENSP00000319623	0.682	Immunoglobulin superfamily DCC subclass member 4
13	9606.ENSP00000482599	0.643	Methyltransferase-like protein 23
14	9606.ENSP00000317334	0.601	T-complex protein 1 subunit alpha
15	9606.ENSP00000300209	0.589	EEF1A lysine methyltransferase 3
16	9606.ENSP00000356064	0.583	Tubby-related protein 4
17	9606.ENSP00000368984	0.578	Exosome complex component RRP45
18	9606.ENSP00000254759	0.536	Ubiquinone biosynthesis O-methyltransferase, mitochondrial
19	9606.ENSP00000262365	0.530	Putative protein N-methyltransferase FAM86B2
20	9606.ENSP00000352182	0.530	Protein FAM86C1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016279	1.000	protein-lysine N-methyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0036211	0.995	protein modification process
GO:0050789	0.987	regulation of biological process
GO:0018193	0.986	peptidyl-amino acid modification
GO:0006479	0.986	protein methylation
GO:0050794	0.982	regulation of cellular process
GO:0018022	0.980	peptidyl-lysine methylation
GO:0080090	0.968	regulation of primary metabolic process
GO:0018023	0.959	peptidyl-lysine trimethylation
GO:0051171	0.954	regulation of nitrogen compound metabolic process
GO:0031323	0.952	regulation of cellular metabolic process
GO:0019219	0.935	regulation of nucleobase-containing compound metabolic process
GO:0065009	0.910	regulation of molecular function
GO:0032879	0.894	regulation of localization
GO:0062012	0.892	regulation of small molecule metabolic process
GO:1903578	0.883	regulation of ATP metabolic process
GO:0048518	0.871	positive regulation of biological process
GO:0034762	0.870	regulation of transmembrane transport
GO:0031326	0.783	regulation of cellular biosynthetic process
GO:0048522	0.621	positive regulation of cellular process
GO:0044093	0.492	positive regulation of molecular function
GO:0050790	0.476	regulation of catalytic activity
GO:0051931	0.327	regulation of sensory perception
GO:0043085	0.322	positive regulation of catalytic activity
GO:0031646	0.320	positive regulation of nervous system process
GO:0051930	0.317	regulation of sensory perception of pain

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0016020	0.998	membrane
GO:0031090	0.982	organelle membrane
GO:0031966	0.970	mitochondrial membrane
GO:0019866	0.965	organelle inner membrane
GO:0030061	0.963	mitochondrial crista
GO:0032991	0.608	protein-containing complex
GO:0005829	0.484	cytosol
GO:0070013	0.379	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:51736	1.000	L-lysyl-[protein] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl-[protein] + S-adenosyl-L-homocysteine

[back to server]