StarFunc result for job id Q6P587

User Input

>input (224 residues)
MGIMAASRPLSRFWEWGKNIVCVGRNYADHVREMRSAVLSEPVLFLKPSTAYAPEGSPIL
MPAYTRNLHHELELGVVMGKRCRAVPEAAAMDYVGGYALCLDMTARDVQDECKKKGLPWT
LAKSFTASCPVSAFVPKEKIPDPHKLKLWLKVNGELRQEGETSSMIFSIPYIISYVSKII
TLEEGDIILTGTPKGVGPVKENDEIEAGIHGLVSMTFKVEKPEY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6P587	1.000	1.000	1.541E-51	224	1.000	1.000	Q6P587.pdb.gz	FAHD1_HUMAN Acylpyruvase FAHD1, mitochondrial OS=Homo sapiens OX=9606 GN=FAHD1 PE=1 SV=2
2	AFDB:Q8R0F8	0.973	0.960	5.782E-46	227	0.866	0.855	Q8R0F8.pdb.gz	FAHD1_MOUSE Acylpyruvase FAHD1, mitochondrial OS=Mus musculus OX=10090 GN=Fahd1 PE=1 SV=2
3	PDB:6fogA	0.966	0.993	1.334E-45	218	0.973	1.000	6fogA.pdb.gz	Structural basis for the bi-functionality of human oxaloacetate decarboxylase FAHD1.
4	PDB:6sbiA	0.961	0.996	3.979E-43	216	0.848	0.880	6sbiA.pdb.gz	Structural and functional comparison of fumarylacetoacetate domain containing protein 1 in human and mouse.
5	AFDB:Q93ZE5	0.952	0.956	2.123E-34	223	0.518	0.520	Q93ZE5.pdb.gz	FAHD1_ARATH Probable acylpyruvase FAHD1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=FAHD1 PE=1 SV=1
6	AFDB:P34673	0.933	0.977	3.643E-34	214	0.446	0.467	P34673.pdb.gz	FAHD1_CAEEL Fumarylacetoacetate hydrolase domain-containing protein 1 OS=Caenorhabditis elegans OX=6239 GN=fahd-1 PE=3 SV=1
7	AFDB:Q9LUR3	0.947	0.947	2.799E-33	224	0.473	0.473	Q9LUR3.pdb.gz	FAHD2_ARATH Probable acylpyruvase FAHD2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=FAHD2 PE=1 SV=1
8	AFDB:P53889	0.884	0.768	5.764E-28	259	0.402	0.347	P53889.pdb.gz	FMP41_YEAST Uncharacterized mitochondrial hydrolase FMP41 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FMP41 PE=1 SV=1
9	AFDB:Q96GK7	0.840	0.605	4.487E-25	314	0.357	0.255	Q96GK7.pdb.gz	FAH2A_HUMAN Fumarylacetoacetate hydrolase domain-containing protein 2A OS=Homo sapiens OX=9606 GN=FAHD2A PE=1 SV=1
10	PDB:1nkqA	0.833	0.758	2.003E-24	247	0.402	0.364	1nkqA.pdb.gz	Crtystal Structure of Yeast Hypothetical Protein YNQ8_YEAST
11	AFDB:Q3TC72	0.849	0.614	2.010E-24	313	0.348	0.249	Q3TC72.pdb.gz	FAHD2_MOUSE Fumarylacetoacetate hydrolase domain-containing protein 2A OS=Mus musculus OX=10090 GN=Fahd2 PE=1 SV=1
12	AFDB:G8BL05	0.888	0.682	5.916E-24	294	0.348	0.265	G8BL05.pdb.gz	G8BL05_CANPC Fumarylacetoacetase-like C-terminal domain-containing protein OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) OX=578454 GN=FPH1 PE=3 SV=1
13	AFDB:O86042	0.784	0.911	9.683E-22	192	0.263	0.307	O86042.pdb.gz	NAGK_RALSP Fumarylpyruvate hydrolase OS=Ralstonia sp. OX=54061 GN=nagK PE=1 SV=1
14	PDB:3bqbX	0.737	0.576	1.355E-15	291	0.214	0.165	3bqbX.pdb.gz	Structural insight into substrate binding and catalysis of a novel 2-keto-3-deoxy-D-arabinonate dehydratase illustrates common mechanistic features of the FAH superfamily
15	PDB:1hyoB	0.760	0.423	9.136E-12	419	0.237	0.126	1hyoB.pdb.gz	Mechanistic inferences from the crystal structure of fumarylacetoacetate hydrolase with a bound phosphorus-based inhibitor.
16	PDB:2wqtA	0.668	0.581	4.345E-11	262	0.138	0.118	2wqtA.pdb.gz
17	PDB:4nenA	0.112	0.042	1.397E-1	1063	0.112	0.024	4nenA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
18	PDB:4lnvB	0.171	0.049	3.873E-1	1063	0.076	0.016	4lnvB.pdb.gz
19	PDB:4f38B	0.178	0.201	4.366E-1	192	0.071	0.083	4f38B.pdb.gz	Quantitative Analysis of Prenylated RhoA Interaction with Its Chaperone, RhoGDI.
20	PDB:7skuA	0.110	0.092	4.366E-1	301	0.125	0.093	7skuA.pdb.gz	Measles and Nipah virus assembly: Specific lipid binding drives matrix polymerization.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6P587	6.37e-168	463	224	1.000	1.000	FAHD1_HUMAN Acylpyruvase FAHD1, mitochondrial OS=Homo sapiens OX=9606 GN=FAHD1 PE=1 SV=2
2	Q8R0F8	6.89e-149	415	227	0.866	0.855	FAHD1_MOUSE Acylpyruvase FAHD1, mitochondrial OS=Mus musculus OX=10090 GN=Fahd1 PE=1 SV=2
3	Q93ZE5	2.00e-83	249	223	0.518	0.520	FAHD1_ARATH Probable acylpyruvase FAHD1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=FAHD1 PE=1 SV=1
4	Q9LUR3	1.74e-73	224	224	0.473	0.473	FAHD2_ARATH Probable acylpyruvase FAHD2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=FAHD2 PE=1 SV=1
5	P34673	1.69e-71	218	214	0.442	0.463	FAHD1_CAEEL Fumarylacetoacetate hydrolase domain-containing protein 1 OS=Caenorhabditis elegans OX=6239 GN=fahd-1 PE=3 SV=1
6	P53889	1.75e-46	156	259	0.397	0.344	FMP41_YEAST Uncharacterized mitochondrial hydrolase FMP41 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FMP41 PE=1 SV=1
7	Q96GK7	5.70e-42	146	314	0.353	0.252	FAH2A_HUMAN Fumarylacetoacetate hydrolase domain-containing protein 2A OS=Homo sapiens OX=9606 GN=FAHD2A PE=1 SV=1
8	Q3TC72	1.57e-41	145	313	0.353	0.252	FAHD2_MOUSE Fumarylacetoacetate hydrolase domain-containing protein 2A OS=Mus musculus OX=10090 GN=Fahd2 PE=1 SV=1
9	G8BL05	3.25e-35	128	294	0.353	0.269	G8BL05_CANPC Fumarylacetoacetase-like C-terminal domain-containing protein OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) OX=578454 GN=FPH1 PE=3 SV=1
10	O86042	8.79e-26	100	192	0.259	0.302	NAGK_RALSP Fumarylpyruvate hydrolase OS=Ralstonia sp. OX=54061 GN=nagK PE=1 SV=1
11	O86346	9.59e-06	48.1	644	0.210	0.073	O86346_MYCTU Possible bifunctional enzyme: 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase (HHDD isomerase) + cyclase/dehydrase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0939 PE=1 SV=1
12	Q90464	3.7	29.6	108	0.067	0.139	Q90464_DANRE HER-2 protein OS=Danio rerio OX=7955 GN=HER-2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01557 FAA_hydrolase	6.6e-59	211.0	Fumarylacetoacetate (FAA) hydrolase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003804390.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008961333.1	0.963	Fumarylacetoacetate hydrolase
2	9597.XP_008959226.1	0.884	Belongs to the GST superfamily.
3	9597.XP_008962714.1	0.831	Flavoprotein (FP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q)
4	9597.XP_003824573.1	0.819	Fumarate hydratase, mitochondrial
5	9597.XP_003814497.1	0.814	Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
6	9597.XP_003811870.1	0.810	Succinate dehydrogenase cytochrome b560 subunit, mitochondrial isoform X1
7	9597.XP_003805514.1	0.804	Membrane-anchoring subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q)
8	9597.XP_008964241.1	0.804	Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial-like
9	9597.XP_003821404.1	0.692	Cardiolipin synthase 1
10	9597.XP_003829094.1	0.689	Actin-binding LIM protein 3 isoform X1
11	9597.XP_008960544.1	0.689	Tumor protein D52 like 2
12	9597.XP_008960184.1	0.617	Sorbitol dehydrogenase
13	9597.XP_003814351.1	0.592	Hydroxysteroid 17-beta dehydrogenase 14
14	9597.XP_003808214.1	0.584	N-acetyl-D-glucosamine kinase isoform X1
15	9597.XP_008949194.1	0.583	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 691 ESTs, 1 Protein, and 98% coverage of the annotated genomic feature by RNAseq alignments
16	9597.XP_003831412.1	0.574	Alcohol dehydrogenase, iron containing 1
17	9597.XP_008957944.1	0.557	DnaJ heat shock protein family (Hsp40) member C14
18	9597.XP_003817832.1	0.541	Arrestin domain-containing protein 2
19	9597.XP_003807671.1	0.540	N-acetylglucosamine-1-phosphotransferase subunit gamma
20	9597.XP_008959280.1	0.538	Interleukin 17 receptor C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016831	1.000	carboxy-lyase activity
GO:0005488	0.999	binding
GO:0016822	0.994	hydrolase activity, acting on acid carbon-carbon bonds
GO:0008948	0.965	oxaloacetate decarboxylase activity
GO:0005515	0.955	protein binding
GO:0016823	0.929	hydrolase activity, acting on acid carbon-carbon bonds, in ketonic substances
GO:0043167	0.710	ion binding
GO:0034545	0.440	fumarylpyruvate hydrolase activity
GO:0043169	0.365	cation binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0044237	0.994	cellular metabolic process
GO:0071704	0.993	organic substance metabolic process
GO:0043436	0.976	oxoacid metabolic process
GO:0019752	0.968	carboxylic acid metabolic process
GO:0032787	0.844	monocarboxylic acid metabolic process
GO:0006090	0.765	pyruvate metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.993	intracellular organelle lumen
GO:0005634	0.974	nucleus
GO:0005829	0.954	cytosol
GO:0016020	0.907	membrane
GO:0031981	0.803	nuclear lumen
GO:0005654	0.760	nucleoplasm
GO:0031090	0.509	organelle membrane
GO:0031967	0.448	organelle envelope
GO:0005759	0.311	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:4.1.1.-	1.000	Carboxy-lyases.
EC:3.7.-.-	0.994	Acting on carbon-carbon bonds.
RHEA:15641	0.965	H(+) + oxaloacetate = CO2 + pyruvate
EC:4.1.1.112	0.965	oxaloacetate decarboxylase.
EC:1.1.1.40	0.965	malate dehydrogenase (oxaloacetate-decarboxylating) (NADP(+)).
EC:1.1.1.38	0.965	malate dehydrogenase (oxaloacetate-decarboxylating).
EC:3.7.1.-	0.929	In ketonic substances.
RHEA:26168	0.440	3-fumarylpyruvate + H2O = fumarate + H(+) + pyruvate
EC:3.7.1.20	0.440	3-fumarylpyruvate hydrolase.

[back to server]